Details for Lyrate rockcress Locus 16047512

Position : sca3 ( 5`- 7699191 .. 7697046 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047512

Protein [Map View]
MDPSVGDPHHPPQFTPFPPFPTSNHFVSGAVPALNHHPFNNNNHVFQPQPQTQIPQPSMIQVPPHPINHPPYSEMICAAI
AALNEPDGSSKMAISRYIERCHPGLTSAHAALLTHHLKTLKNSGVLTMVKKSYKIASSSTPPASVAVAAAAAAQGLDVPR
SVILPSTNSTVNDPMAVSASQPLKRGRGRPPKPKPEGQQQQPINAQPIQVQSNGQPIWQLQQVQLPVTVPVPVTESAKRG
PGRPRKNGAAAVAPIVQASVMAGIMKRRGRPPGRRAAGRQRKPKSVSATASVYPYVANGARRRGRPRRVVDPSSIVTVAP
VGGENVAAVAPGMKRGRGRPPKIGGVISRLMKPKRGRGRPVGRPRKFATSVTTGAQDSGELKKKFDIFQEKVKEIVKVLK
DGVTSENQAVVQAIKDLEALTVTETVVEPQVEEVPPEETAEPLTEAEAAETQGGQEEGQEREGGEAQTQTEAEAMQEALF
*

DNA
ATGGATCCATCTGTTGGTGATCCTCATCATCCTCCTCAGTTCACCCCTTTCCCTCCTTTTCCCACCTCCAACCACTTCGT
CTCCGGCGCCGTCCCTGCTCTAAATCATCATCCCTTCAACAACAACAACCATGTCTTCCAACCGCAGCCGCAAACGCAAA
TTCCCCAACCGTCGATGATTCAGGTCCCTCCACATCCCATCAACCACCCTCCTTACTCCGAGATGATTTGCGCAGCGATT
GCGGCGTTAAACGAACCGGATGGTTCAAGCAAGATGGCAATTTCGAGATACATCGAGAGATGTCATCCCGGTTTAACTTC
TGCTCATGCTGCTTTGTTGACACATCATCTCAAGACTTTGAAGAACAGTGGTGTTCTTACTATGGTTAAGAAATCTTACA
AAATTGCTAGTTCTTCTACTCCTCCTGCCAGTGTTGCTGTTGCTGCTGCTGCCGCCGCTCAAGGTCTCGATGTTCCCAGA
TCTGTGATTCTCCCTTCAACTAACAGCACCGTCAACGATCCCATGGCTGTCTCTGCTTCTCAGCCTCTGAAACGAGGTCG
TGGTCGTCCTCCTAAACCTAAACCCGAAGGTCAACAACAACAACCCATCAATGCTCAGCCTATTCAAGTCCAGTCTAACG
GACAGCCAATCTGGCAACTGCAACAAGTCCAATTACCTGTGACTGTTCCGGTTCCTGTTACGGAGTCGGCTAAGAGAGGA
CCCGGTCGTCCAAGGAAGAACGGAGCTGCTGCTGTTGCGCCAATTGTTCAAGCTTCGGTTATGGCTGGAATCATGAAACG
TAGAGGTAGACCACCAGGTCGTAGAGCTGCTGGAAGACAGAGGAAGCCCAAATCTGTTTCTGCTACTGCTTCTGTGTATC
CGTATGTTGCTAATGGTGCTAGACGTAGAGGAAGGCCTAGGAGAGTCGTTGACCCTAGCAGCATCGTTACCGTTGCTCCA
GTAGGTGGTGAAAATGTGGCAGCGGTTGCGCCGGGAATGAAGCGTGGACGAGGACGACCACCGAAGATTGGTGGTGTTAT
CAGTAGGCTTATGAAGCCTAAGAGAGGACGAGGACGTCCTGTAGGTAGACCCAGAAAGTTTGCAACATCAGTCACGACTG
GGGCACAAGATTCTGGAGAACTCAAGAAAAAGTTTGATATTTTTCAAGAGAAAGTAAAAGAAATTGTGAAGGTGTTGAAA
GATGGAGTTACAAGCGAGAATCAAGCGGTGGTGCAAGCCATAAAAGATCTGGAAGCACTAACAGTGACGGAGACGGTTGT
TGAGCCACAGGTGGAAGAAGTGCCGCCAGAGGAGACTGCTGAACCGCTCACTGAAGCTGAAGCTGCTGAAACACAAGGAG
GACAGGAAGAGGGACAAGAAAGAGAAGGAGGAGAAGCACAGACCCAGACAGAAGCAGAGGCAATGCAAGAAGCTCTGTTC
TGA