Details for Lyrate rockcress Locus 16047476

Position : sca3 ( 5`- 10060212 .. 10060658 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479767 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047476

Protein [Map View]
MASKSGSGGLREPPNEQAVLNMYEAKRSELSQIYSNITELEMQVSEHSLVINAIQPLDQSRKCFRMIGGVLVERTIKEVL
PAVQRNKEGLEEVVRKLYETLEKKKKDLTDFEAMYKIRIRKQDDNKEEGNKKEGNAQGVLVGAASSSQ*

DNA
ATGGCCAGCAAATCTGGAAGCGGTGGCCTAAGAGAACCGCCGAATGAGCAAGCTGTTTTGAACATGTATGAAGCCAAGAG
ATCAGAGCTTAGCCAAATCTACTCCAACATAACTGAACTCGAGATGCAAGTGAGCGAACATTCTCTGGTCATTAACGCCA
TTCAGCCTCTTGACCAATCGAGGAAATGCTTCCGCATGATAGGAGGCGTTCTTGTCGAGAGAACCATCAAAGAGGTACTC
CCAGCTGTCCAACGTAACAAGGAAGGGCTTGAAGAGGTTGTGAGGAAGCTATACGAGACATTGGAGAAGAAGAAGAAAGA
TCTTACAGACTTTGAAGCTATGTATAAGATCAGGATAAGGAAACAAGACGATAACAAGGAAGAAGGGAACAAGAAGGAAG
GTAATGCTCAAGGTGTTCTTGTTGGAGCTGCCAGTTCGAGCCAGTAA