Details for Lyrate rockcress Locus 16047474

Position : sca3 ( 5`- 8115994 .. 8116503 -3` )
Annotation : [B2G] ribosomal protein s17 family protein
External links : CoGe
PGDD synteny : 16047474

Protein [Map View]
MKAVIGTVVSNKMQKSVVVAVDRLFHNKLYNRYVKRTSKFMAHDEKDSCNIGDRVKLDPSRPLSKHKHWIVSEIIKKARI
YSPLAAAAALNSSSSIAEQSPVSSS*

DNA
ATGAAGGCAGTGATAGGCACAGTGGTGTCGAACAAAATGCAGAAGTCGGTGGTGGTCGCCGTCGACAGACTTTTCCATAA
CAAGCTCTACAATCGCTATGTCAAACGTACTTCCAAGTTCATGGCTCACGATGAAAAGGACTCCTGTAACATCGGCGATC
GAGTGAAATTGGATCCGTCAAGGCCTTTGAGCAAGCATAAGCATTGGATTGTTTCAGAGATCATAAAGAAAGCACGCATT
TACTCTCCACTGGCTGCTGCTGCTGCTCTCAATTCCTCCTCCTCCATTGCTGAGCAGTCTCCTGTTTCGTCTTCCTAA