Details for Lyrate rockcress Locus 16047440

Position : sca3 ( 5`- 3186368 .. 3184495 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047440

Protein [Map View]
MASQPAGGCPPKPWEQEGNTSGPTPFRPPSNTSTAGSVEASGTANPGEVVPPPVNRTNTAANMNALSRPVPARPWEQQNY
GNTMGGGYGSNLGMTSGYGSGTYGSALGGYGSSYGGGMYGGSSMYRGGYGGAGGLYGSSGMYGGGAMGGYGGTMGGYGMG
MGTGMGMGMGMGMGPYGGQDPNDPFNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGGML
YGELARFVLRMLGVRTRPRKMQQPPQGPNGLPLPHQPHGNQNYIEGPKTAAPGGGGGWDNVWGN*

DNA
ATGGCGTCTCAGCCTGCAGGTGGTTGTCCTCCTAAACCTTGGGAACAAGAAGGAAATACATCTGGTCCTACTCCTTTCAG
GCCTCCTTCTAATACTAGCACGGCTGGTTCAGTTGAGGCTTCTGGCACAGCTAATCCTGGTGAAGTAGTTCCTCCCCCCG
TGAACCGGACTAATACAGCTGCTAATATGAATGCACTGAGTAGGCCTGTACCGGCTAGACCTTGGGAGCAGCAGAATTAT
GGGAACACTATGGGAGGAGGTTATGGTTCAAATCTAGGTATGACCTCTGGGTATGGGTCAGGTACATATGGTTCAGCATT
AGGTGGGTATGGTTCATCATATGGTGGTGGGATGTATGGGGGTAGTAGCATGTATAGAGGAGGTTATGGTGGTGCTGGTG
GTCTCTATGGAAGTTCAGGCATGTATGGTGGTGGCGCGATGGGTGGTTATGGTGGCACGATGGGTGGTTATGGTATGGGT
ATGGGAACGGGAATGGGAATGGGGATGGGAATGGGAATGGGTCCTTATGGTGGTCAAGATCCAAATGACCCTTTTAATCA
GCCTCCATCTCCACCAGGCTTCTGGATATCATTTCTCCGTGTGATGCAAGGTGCTGTGAATTTCTTTGGCCGTGTAGCGA
TGCTTATAGATCAAAACACACAGGCCTTTCACATGTTCATGTCTGCCCTTCTTCAGCTATTTGATCGTGGTGGTATGTTA
TATGGAGAATTAGCAAGATTTGTATTGCGTATGCTTGGGGTGAGAACAAGGCCTAGAAAGATGCAGCAGCCCCCACAAGG
GCCTAATGGACTCCCTTTACCCCACCAGCCACATGGAAACCAGAACTACATCGAGGGGCCTAAAACTGCTGCACCAGGTG
GTGGCGGTGGTTGGGACAATGTATGGGGCAACTAA