Details for Lyrate rockcress Locus 16047438

Position : sca3 ( 5`- 5681958 .. 5684356 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478784 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047438

Protein [Map View]
MNKDMLLHQHHQPQQDENMSNLTSASGDQASVSSGNITEASGSNYFPHHQQLQEQQQQFFVPDSQPQKKRRNQPGNPDPD
SEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRSNKEVIRKKVYVCPEASCVHHDPSRALGDLTG
IKKHFCRKHGEKKWKCDKCSKKYAVHSDCKAHSKTCGTKEYRCDCGTLFSRRDSFITHRAFCEALAEETAREVVIPQNQN
NQPNPLLIHQSSSHPHPHHHQTQPNINVSSSSSSSHNHNIINSLHFDTNNGTNNSNSSNNHLHTFPMKKEQQSNDHIMNY
HHSIPPWLAPQPHDLTSSNPNPSNGGGGGSLFSLASPAMSATALLQKAAQMGSTKTPPLPPTTDYERSTRNNNLTTTMAA
MMTSPSGFISSNNNNQVLFQDYNASGFDHHGGEEAFDDTFGGFLRTSEATTAAGSEKSKSGGGEGLTRDFLGLRPLMSHN
EILSFAGLGNCINSSASDQLHPKPWQG*

DNA
ATGAACAAAGACATGTTACTTCATCAGCATCACCAACCACAACAAGACGAGAATATGTCGAATCTAACATCAGCTTCTGG
GGATCAAGCAAGTGTCTCTTCAGGAAACATAACCGAAGCAAGTGGTTCTAATTATTTCCCTCATCATCAGCAACTTCAAG
AACAGCAACAGCAGTTCTTTGTTCCAGATTCGCAGCCTCAAAAGAAGAGGAGAAACCAACCAGGGAATCCAGACCCAGAC
TCAGAAGTGATAGCTTTATCACCAAAAACACTAATGGCAACAAACAGATTCGTGTGTGAGATCTGCAACAAAGGTTTCCA
AAGAGACCAGAATCTACAGCTTCATAGAAGAGGTCACAATCTGCCATGGAAGCTGAAACAAAGATCCAACAAAGAAGTGA
TAAGGAAGAAAGTGTATGTATGTCCAGAAGCAAGTTGTGTCCACCATGATCCATCTAGAGCTCTCGGTGACTTAACCGGA
ATCAAGAAGCACTTCTGCAGAAAACATGGAGAGAAGAAGTGGAAATGTGATAAGTGTTCAAAGAAATATGCTGTTCATTC
AGATTGCAAGGCTCATTCTAAGACTTGTGGCACCAAAGAATACAGATGTGACTGTGGCACTCTCTTTTCTAGGAGGGATA
GTTTCATAACTCATAGAGCATTTTGTGAAGCATTGGCTGAAGAGACTGCAAGAGAAGTAGTAATACCACAAAACCAAAAT
AATCAACCAAACCCTCTTTTGATTCATCAATCTTCTTCTCATCCTCATCCTCATCATCATCAAACACAACCAAACATAAA
CGTCTCTTCTTCTTCATCCTCCTCCCACAACCACAACATCATCAATAGCCTTCACTTCGACACCAACAATGGTACTAATA
ATAGCAACAGCAGCAACAACCATCTCCATACATTTCCCATGAAGAAAGAGCAACAAAGTAATGACCATATCATGAATTAC
CACCATAGTATCCCTCCTTGGCTTGCTCCTCAGCCACACGATCTCACATCTTCAAACCCTAACCCTAGTAATGGTGGAGG
AGGAGGAAGTTTGTTCTCTCTGGCTTCTCCGGCTATGTCAGCCACCGCATTGCTCCAGAAAGCAGCCCAAATGGGTTCTA
CAAAGACACCTCCTTTACCACCAACCACGGACTACGAAAGGTCAACTCGTAATAACAACCTCACGACCACAATGGCGGCG
ATGATGACGTCACCATCTGGATTCATCAGCTCCAACAACAACAATCAAGTTTTGTTTCAAGACTACAACGCATCCGGGTT
TGATCATCACGGCGGAGAAGAAGCATTCGACGATACATTCGGCGGGTTCTTGAGAACAAGCGAAGCTACAACCGCCGCAG
GATCAGAGAAGAGTAAAAGCGGTGGAGGAGAAGGTTTGACGAGAGATTTCTTGGGGCTAAGACCGTTAATGTCTCATAAC
GAGATTCTAAGTTTTGCTGGTCTTGGAAATTGCATTAATAGCTCTGCTTCAGATCAGCTTCATCCCAAGCCTTGGCAGGG
TTAG