Details for Lyrate rockcress Locus 16047426

Position : sca3 ( 5`- 3139608 .. 3140306 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478063 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047426

Protein [Map View]
MAAITALALRSPVFLPPSSATTPRFHGFTKLSARVFFPLKPFPSLSIQNPKSKSIRISASASPMTPTIPTEKSTTRPSTL
TGSTRSLATLAALTIAVTRVLAQKLSLAIQTSSPAIADGLRFSLSTAGPVFFASLRDRPPGYLNTPLTVVAVGIKKWLDI
YSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPIFDTLDVSPLLAFAVLGTLGSIVHGSTG*

DNA
ATGGCCGCCATTACAGCTCTCGCTCTCCGCTCTCCTGTTTTTCTTCCTCCATCATCCGCCACAACCCCTAGATTCCATGG
CTTCACCAAGCTATCAGCTCGTGTCTTCTTTCCTCTTAAACCCTTCCCTTCTCTATCCATCCAAAACCCTAAATCTAAAT
CCATCCGAATTTCCGCATCCGCATCGCCGATGACACCAACCATCCCGACGGAGAAATCAACAACTCGACCATCGACACTC
ACCGGGTCGACTCGGTCTCTCGCTACTCTCGCGGCTTTAACAATCGCTGTAACCAGAGTCTTAGCTCAGAAACTCTCTCT
TGCGATCCAGACTTCAAGTCCCGCAATCGCAGACGGATTACGATTCTCTCTCAGTACCGCCGGACCGGTCTTCTTCGCGT
CGCTCCGAGATCGTCCTCCGGGGTACTTGAACACGCCGCTTACGGTGGTTGCGGTGGGGATAAAGAAGTGGTTAGACATA
TACAGTGGGGTTTTGATGGTTAGGGTTTTGCTCAGTTGGTTCCCTAATATCCCTTGGGAAAGACAGCCTTTGTCTGCCAT
TAGAGATCTCTGTGATCCTTACTTGAATCTCTTCAGAAACATCATTCCTCCTATCTTCGATACTCTTGATGTTAGTCCAT
TGCTTGCTTTCGCGGTTCTTGGTACACTTGGATCTATTGTTCATGGCAGCACCGGATAG