Details for Lyrate rockcress Locus 16047401

Position : sca3 ( 5`- 3874622 .. 3872295 -3` )
Annotation : [B2G] kinase family protein
External links : CoGe
PGDD synteny : 16047401

Protein [Map View]
MEAHFFLLFLSLILLFLPKPGSGFGSSGPIAAAFGGSAFFCAIDASGRQDVICWGKNYSSPSSPSSSSSSSSLASSTSAS
YNIPSMAVLSGGDGFLCGILSNTSQAFCFSSLGSSSGMDLVPLAYRTTAYSQIAAGTSHVCAVRGAYYSDHDSGTVDCWE
IARATNNNSLIAKENPNFYDQIVRNLVFNNIVSGDGFSCGGIRDGGLLCFGPNSSNLGFNTTSDNFQVLAAGKNSVCAIL
NSSREVKCWGEDESFVDSPMNDSRFVSLTAGPRHFCGIREDNHEVECWGNSNFSLIPKGSGFKAIASSDFIVCGIREEDL
VLDCWMVNGSSTLAYDPPLELCSPGMCRAGPCYEKEFAFNASILNEPDLTSLCVRRELMVCSPCGSDCSHGFFLSSSCTE
NSDRICTPCSLCQNSSCSDICKLHNSNFPDKHWHQLQRLVLIIGSCASALLILIIGCCIVPRVIITSPNKEDGAANQFKS
CIGKPDLDTEPLENVSPAPSVTPFAQVFRLSELKDATNGFKEFNELGRGSYGFVYKALLPDGRQVAVKRANAATIIHTNT
REFETELEILCNIRHCNIVNLLGYSTEMGERLLVYEYMPHGTLHDHLHSGFSPLSWSLRIKIAMQTAKGLEYLHNEAEPR
IVHGDVKSSNVLLDAEWVARVADFGLVTSSNEKKLDIKRDVYDFGVVLLEILTGRKRHDRDCDPPEIAEWAVTVIREGRA
AAIVDKYIALPRNVEPLLKLADVAELCVREDPNQRPTMSELANWLEQVARDALIF*

DNA
ATGGAAGCCCATTTCTTTCTCCTCTTTCTCTCTCTCATTCTCCTGTTTTTGCCCAAACCCGGATCCGGATTTGGATCCTC
TGGCCCAATCGCGGCGGCGTTCGGTGGCTCTGCTTTCTTCTGCGCCATTGATGCTAGTGGTCGTCAAGATGTTATCTGCT
GGGGTAAAAACTATTCATCTCCATCTTCTCCGTCTTCTTCTTCTTCTTCCTCGTCTCTTGCTTCTTCTACTTCTGCAAGC
TACAACATTCCGTCCATGGCGGTTCTTTCAGGTGGAGACGGGTTTCTCTGCGGCATTTTGTCGAACACTTCTCAGGCGTT
TTGTTTTAGTTCACTTGGGTCTTCTTCAGGTATGGATCTTGTCCCTCTAGCTTACCGGACTACTGCTTACTCTCAGATTG
CTGCTGGAACAAGCCATGTCTGTGCTGTTAGAGGAGCTTACTATTCGGATCACGATTCTGGGACTGTTGATTGTTGGGAG
ATAGCAAGAGCTACGAATAACAACAGCTTAATCGCGAAAGAGAATCCAAACTTCTATGATCAGATTGTTCGTAATCTCGT
CTTCAACAATATCGTTTCTGGTGATGGGTTTAGCTGTGGTGGAATCAGAGATGGTGGATTGCTCTGTTTTGGCCCCAATT
CTTCTAATTTAGGGTTTAACACAACTTCTGATAACTTCCAAGTCTTAGCCGCCGGAAAAAACTCCGTTTGTGCGATTCTA
AACTCATCCCGGGAGGTAAAATGTTGGGGAGAAGATGAATCTTTTGTTGATTCTCCGATGAATGATTCTCGATTCGTCTC
GCTAACCGCTGGTCCTCGCCATTTCTGCGGAATCCGTGAGGATAATCATGAGGTTGAATGTTGGGGAAACTCTAATTTCT
CTTTGATTCCAAAAGGTTCCGGATTTAAGGCAATTGCTTCATCTGATTTCATTGTTTGTGGTATAAGAGAAGAGGATCTT
GTTCTTGATTGCTGGATGGTTAACGGTTCGTCGACATTAGCTTACGATCCTCCGTTAGAGCTCTGCAGTCCAGGGATGTG
TAGAGCTGGTCCTTGTTATGAAAAAGAGTTTGCTTTCAACGCAAGTATCCTAAATGAACCTGACCTAACGAGTTTGTGTG
TAAGGAGAGAGTTAATGGTCTGTTCACCTTGCGGCTCGGATTGCTCTCACGGATTCTTCTTGTCAAGTTCGTGCACCGAG
AACTCTGATCGGATATGTACGCCTTGCTCGCTCTGTCAAAACAGTTCTTGTTCAGACATATGTAAGCTTCATAACAGCAA
TTTTCCAGATAAGCATTGGCATCAACTACAGAGACTTGTTCTCATCATCGGATCTTGCGCATCCGCTCTATTGATCCTCA
TAATTGGTTGCTGTATCGTTCCACGGGTTATCATCACTAGTCCTAATAAAGAAGACGGCGCAGCGAATCAATTCAAATCT
TGCATAGGAAAGCCTGATTTAGACACTGAGCCACTTGAAAATGTCTCCCCTGCTCCATCGGTAACGCCTTTTGCTCAAGT
GTTTAGACTCTCTGAGCTTAAAGACGCGACCAACGGGTTTAAAGAGTTCAATGAGTTAGGCAGAGGAAGCTATGGGTTTG
TCTACAAAGCCTTGTTGCCGGACGGGAGGCAAGTAGCGGTGAAGAGAGCAAACGCAGCAACCATAATCCACACAAACACT
AGAGAATTTGAGACAGAATTGGAGATTCTCTGCAACATTAGGCATTGCAACATTGTGAATCTCCTCGGTTACTCGACCGA
AATGGGAGAGAGGCTTCTTGTTTACGAGTACATGCCTCACGGTACGCTTCACGATCATCTACACAGTGGGTTTTCGCCAT
TGAGTTGGAGCTTAAGGATCAAAATCGCTATGCAAACCGCAAAAGGTCTTGAGTATCTACACAATGAAGCTGAGCCTAGA
ATCGTTCATGGCGATGTGAAGTCTTCGAATGTACTATTGGACGCGGAATGGGTGGCGAGGGTTGCGGATTTCGGGCTCGT
GACATCGTCGAACGAGAAGAAGTTGGACATCAAAAGAGATGTTTATGACTTTGGAGTTGTCTTGTTAGAGATTTTAACCG
GAAGGAAACGTCATGATAGGGACTGTGATCCGCCGGAGATTGCTGAATGGGCAGTTACGGTGATCAGAGAAGGCAGAGCA
GCGGCGATTGTGGATAAGTATATTGCGTTGCCGAGAAACGTGGAGCCGTTGTTGAAACTTGCTGACGTAGCGGAGTTGTG
TGTACGCGAGGATCCGAATCAACGACCAACGATGTCGGAACTTGCGAATTGGTTGGAACAGGTCGCAAGAGATGCATTGA
TCTTCTAG