Details for Lyrate rockcress Locus 16047400

Position : sca3 ( 5`- 10664047 .. 10666601 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16047400

Protein [Map View]
MGQQQSKGELLYQQVSYGNSEGIRTLHRDGADLEWMDREGKTALILACMNSELYDVAKTLIELGSNVNAYRPGRNAGTPL
HHAAKRGLENTVKLLLSHGANPLVLNDDCQTPLEVARVKGFSNVVRAIEKHICLFSGWMREFYGPTFLDLFAPQLLSRRV
WVVIVPTGSRNPTKPFKLELVVYASLQDAQPRTMMPLWKANLEEPKAKQSDTSVMIVDNSTIPSRRMKKRRVYASHGRRR
PQVVRQTRLKLAPATEGDSQQLKWFCDACKGIPQPMRPPVFLQTAPSAPPPPSEDELAMAMNASLHTTMSDPSNLNHHSI
GQASSSSVPSSSTAPPSGKASAFVFNSHGIGIVLESSPSAPPLTDDNISTVDEGPIHYPSIDSTPVDLPSASSLPAPTEG
ERKEDGSTGTCAICLDAPSEAVCVPCGHVAGCMSCLKEIKSKNWGCPVCRAKIDQVIKLYRV*

DNA
ATGGGACAACAGCAATCAAAAGGGGAATTGCTGTATCAGCAAGTGAGTTATGGTAACTCTGAAGGAATTCGAACTCTTCA
TCGAGATGGTGCAGACCTTGAGTGGATGGATAGAGAAGGAAAAACTGCGTTGATCTTGGCTTGTATGAACTCGGAGCTAT
ATGATGTTGCTAAAACTTTGATTGAGTTGGGTTCTAATGTTAATGCTTATCGTCCTGGTCGTAATGCTGGGACTCCTCTG
CACCATGCTGCAAAAAGAGGTCTTGAGAACACTGTTAAGTTACTTCTTTCGCATGGTGCAAATCCACTTGTTCTCAATGA
TGATTGTCAGACACCACTTGAGGTCGCTAGAGTCAAAGGTTTCAGCAATGTCGTACGTGCAATTGAGAAACACATCTGCT
TGTTCTCGGGTTGGATGCGTGAATTTTACGGCCCTACCTTTCTCGACTTATTTGCTCCGCAGCTTCTTTCAAGAAGAGTA
TGGGTAGTCATCGTACCAACTGGTTCAAGAAACCCTACAAAACCTTTCAAGTTGGAGCTGGTTGTGTATGCTAGTTTGCA
GGATGCACAGCCACGCACGATGATGCCTTTGTGGAAAGCAAACTTGGAAGAACCAAAAGCAAAGCAGTCCGATACTTCAG
TGATGATCGTTGATAATTCCACAATCCCAAGCCGCAGGATGAAGAAACGCAGGGTCTACGCCTCCCACGGGAGACGTAGG
CCTCAAGTAGTTAGGCAAACACGTCTTAAACTCGCACCTGCGACTGAAGGTGACAGCCAACAGCTGAAGTGGTTTTGTGA
TGCATGTAAAGGAATTCCACAGCCGATGCGTCCACCGGTCTTTCTCCAAACAGCACCATCTGCTCCACCACCACCATCAG
AAGATGAACTAGCCATGGCAATGAACGCCTCACTTCACACTACTATGAGTGACCCATCAAATCTCAATCACCATTCCATC
GGTCAAGCAAGTTCCTCATCCGTTCCAAGCTCATCAACCGCACCTCCCTCAGGAAAAGCAAGCGCCTTTGTGTTCAATAG
CCATGGAATTGGCATTGTCCTAGAATCTTCACCATCAGCTCCTCCATTGACAGATGATAATATATCAACAGTAGACGAAG
GTCCAATTCATTACCCATCGATCGATTCAACACCCGTCGATCTCCCATCTGCTTCTTCTCTTCCAGCTCCAACCGAAGGT
GAAAGGAAAGAAGACGGGAGCACTGGAACATGTGCGATATGTCTAGATGCTCCATCTGAAGCAGTATGTGTCCCGTGTGG
ACATGTCGCGGGATGTATGTCTTGCTTGAAGGAGATCAAATCCAAGAATTGGGGATGTCCGGTTTGTCGCGCCAAGATCG
ATCAGGTTATTAAGTTGTACCGTGTCTGA