Details for Lyrate rockcress Locus 16047381

Position : sca3 ( 5`- 6380330 .. 6379656 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047381

Protein [Map View]
MENHRETTNSDEPPPDFEFGSLTPTSPSQDSFTENSPADHLFFNGRLLPHSFPAASSIYTKRSISSTTSEYTSRSSSTNS
RSSFGSNSSSTSQSPRTSSCNINKNNSPNNQEPLDLKPPISRCGKTVNTTNNSSYSSPQYKRRKATEMVTASLYRSYSSQ
RWQYVTPVPVKMSGVIRVGGRKKKAARVRKETEERRGSRVMKLWRKLLMAAIFACRECHALEGA*

DNA
ATGGAGAATCATAGAGAAACCACAAACTCCGACGAGCCACCACCGGATTTTGAGTTCGGATCGTTGACTCCAACTTCTCC
GTCGCAAGACTCTTTCACTGAGAATTCTCCCGCCGATCACCTCTTCTTCAACGGCCGTCTCTTGCCACACTCTTTCCCGG
CGGCGAGCAGTATTTATACAAAGCGGTCAATCTCGAGTACGACCAGCGAATACACCTCCCGGAGCAGTAGTACGAACAGC
CGAAGTAGTTTTGGGAGTAATAGCAGCTCAACTTCTCAATCTCCGAGAACGAGCAGTTGCAACATTAACAAGAACAACAG
CCCCAATAATCAAGAGCCACTGGATTTGAAGCCTCCAATTAGCAGATGTGGCAAAACCGTAAATACGACCAACAACAGCT
CGTACTCGTCGCCGCAATACAAGAGGAGGAAAGCGACGGAGATGGTGACAGCGTCTCTATACAGGTCTTATTCATCGCAG
CGGTGGCAATATGTAACTCCGGTACCGGTGAAAATGAGTGGAGTGATAAGGGTCGGTGGCCGGAAGAAGAAGGCGGCGAG
GGTGAGGAAGGAGACGGAGGAGAGAAGAGGGAGTAGGGTGATGAAGTTGTGGAGAAAACTTTTAATGGCGGCAATTTTTG
CTTGTAGAGAGTGTCATGCATTGGAGGGAGCTTGA