Details for Lyrate rockcress Locus 16047363

Position : sca3 ( 5`- 9598934 .. 9596667 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047363

Protein [Map View]
MEDNSPETSEKLISSFIEVTSSSREVAISFLETHQWNLNAAVSTFTKNEVAVAAEPNVPNPKDEQLLRRNRSPFPNLRVR
IPNSSFSAFDGSSGYSPSRLQLRPPFPSYPSSGQFYRLHSKRAAANPFSRHTIKRRQGDGNVRIDDFSGGTGSDSDEALE
NYGGEDNRAIERTEQSSGETDSPELEEELEGVFTYTVTSWSNGFTVDDSSLKTLDDPENAYFLEIISKMESPRELAQVRV
QVKIIRREEENFTESQAGSDSASTEPPALAASLSMSFSGNHGKLKDVDAIFDRAKESAIERFEQSSKVMSGETDSAELQE
QQQEDQPYKVVTSTVTIWRNGFTIDDDPFKSLDDPENAAFLERITSLESPRLLDPLSVQVKLIRREGNFSESPSFHGVGS
TLAESDSVSTNLPTLATSPPPSMGLIVVDPTAPTTSIQLRLADGTRLVTRFNTHHTIRDIRGFIDASRPDGSKDYELLIM
GSPPTRLPDFDQTIEKAGIANSVLVQKF*

DNA
ATGGAAGATAACTCGCCGGAGACGTCGGAAAAATTAATCAGCTCCTTCATTGAGGTCACATCTTCTTCTAGAGAAGTAGC
TATATCTTTTCTTGAAACTCATCAATGGAATCTCAATGCTGCTGTTTCGACCTTCACTAAGAACGAAGTCGCCGTCGCCG
CCGAGCCAAATGTTCCAAACCCTAAAGACGAACAACTTCTCCGACGTAATAGAAGTCCGTTTCCGAATCTTCGAGTCCGT
ATCCCTAATTCATCTTTTTCTGCGTTTGATGGCTCTTCCGGTTACTCTCCGTCGCGGTTACAGTTACGACCACCGTTTCC
GTCGTATCCTTCTAGTGGTCAATTCTATCGTCTTCACTCAAAACGTGCAGCAGCTAATCCATTTTCGAGGCATACGATTA
AACGCCGTCAAGGCGATGGAAATGTCCGTATCGATGATTTCTCCGGTGGAACTGGTAGCGATTCCGATGAAGCTCTGGAG
AATTACGGCGGAGAAGATAATAGAGCTATAGAAAGAACTGAGCAATCATCTGGAGAAACTGATTCACCTGAGCTTGAAGA
AGAGCTTGAAGGAGTCTTTACGTACACTGTAACAAGCTGGAGCAACGGTTTCACTGTCGATGATAGTTCGTTAAAGACGT
TGGATGATCCGGAAAATGCATATTTTCTGGAGATCATATCGAAGATGGAGTCCCCGCGTGAACTCGCTCAAGTCCGTGTT
CAAGTCAAAATCATTAGGCGTGAAGAAGAAAACTTCACTGAATCACAAGCCGGATCAGACTCTGCCTCAACTGAGCCACC
AGCTTTAGCTGCCTCACTATCAATGAGCTTTAGTGGGAACCATGGAAAGCTAAAAGATGTCGATGCGATTTTCGACAGAG
CTAAGGAGTCAGCTATAGAAAGATTTGAGCAATCATCAAAGGTAATGTCTGGAGAAACTGATTCAGCTGAGCTTCAAGAA
CAACAGCAAGAAGACCAGCCATATAAAGTAGTCACGTCCACTGTAACTATTTGGAGGAATGGTTTTACTATCGATGATGA
TCCGTTTAAGAGTTTGGATGACCCGGAAAATGCAGCCTTTCTTGAGAGGATAACAAGTTTGGAGTCCCCACGACTACTTG
ATCCACTTAGTGTTCAAGTCAAACTCATCAGGCGTGAAGGAAACTTCAGTGAATCACCTTCATTCCACGGTGTCGGAAGC
ACTCTAGCCGAATCAGACTCTGTCTCTACTAATCTACCAACTTTAGCCACCTCACCGCCACCATCAATGGGCTTAATAGT
GGTAGATCCTACAGCGCCAACAACCTCGATTCAGCTCAGATTAGCAGACGGCACACGCCTAGTCACCCGTTTCAACACTC
ACCACACCATTAGAGACATTCGAGGCTTCATAGACGCGTCTAGACCAGACGGCTCCAAAGACTACGAATTACTCATCATG
GGGTCTCCTCCTACACGACTGCCTGACTTTGACCAAACCATAGAGAAAGCTGGCATCGCCAACTCTGTCCTCGTCCAAAA
ATTCTAG