Details for Lyrate rockcress Locus 16047352

Position : sca3 ( 5`- 3214181 .. 3215602 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047352

Protein [Map View]
MKVAEKIVILWNDSDGFAATIADALSPNPSSPLRKLEEQIHLPLDKYGVEGAETGGSIVHFVDENGVYQVSIFLLPSYEP
PVLVCAMNELLDLITREVSTLPTIVAPFLVAASKLKFNNRSYEANRRTASLHYVQVGPETEISRLFASRIEKPPPLMQIH
YEPLSCLLHLARVKRLPTSILIGQRSSSLSHKALDQDLQVIHETGELVASWTGLSFSRDRIKWSASKTSKEEESPWRALY
G*

DNA
ATGAAAGTAGCGGAGAAGATTGTTATCCTCTGGAATGATTCCGATGGATTTGCTGCAACCATTGCTGATGCTCTAAGCCC
TAACCCTAGTTCCCCTCTTCGCAAACTAGAAGAACAGATCCACCTTCCGTTGGATAAGTATGGCGTCGAAGGTGCGGAAA
CCGGCGGGAGTATCGTTCATTTCGTCGATGAAAATGGAGTTTATCAGGTCTCGATTTTTCTTCTTCCAAGCTATGAGCCT
CCAGTACTAGTGTGTGCTATGAATGAACTGCTGGACCTAATTACACGGGAAGTGTCAACCCTACCCACAATTGTAGCTCC
TTTTCTTGTGGCGGCATCTAAGCTTAAGTTCAATAACAGATCCTATGAAGCAAATAGAAGAACAGCTAGTCTTCACTACG
TTCAAGTTGGTCCAGAAACAGAGATCAGTAGGCTATTTGCTTCTCGCATCGAGAAACCACCCCCATTGATGCAGATCCAT
TATGAACCTTTGTCATGCTTGCTTCACCTAGCACGTGTCAAACGCCTGCCTACCTCTATTCTCATTGGGCAAAGAAGTAG
TAGCCTATCTCATAAAGCTCTAGATCAAGACCTTCAGGTGATACATGAAACAGGGGAGCTTGTGGCCAGTTGGACCGGAC
TGTCTTTCTCAAGAGACAGAATCAAGTGGAGCGCATCAAAGACATCAAAAGAAGAAGAAAGTCCGTGGCGTGCTCTTTAT
GGTTAA