Details for Lyrate rockcress Locus 16047351

Position : sca3 ( 5`- 9300899 .. 9297916 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_342253 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047351

Protein [Map View]
MAENGFSHLTSLAQSEKAVQELLLQQTPMQATDDHLIEFSEALRTVAKALRGAAEGKALAQAEAAEWKRRYEVERSKNVE
LQHKELSNGVCADESNSQRMEHLAKSPRLYAQEISSNGMERICSHEVLQDGGFNSFTNKLKRKASFKLSWGCKGMANDQH
KKEIVSFERGNISTAERSSKQISLTWESDPQTVLIITKPNSTSVRVLSVDMVRWLRTQKGLNIYVEPRVKEELLSESSSF
NFVQTWEDDKEISLLHTKVDLLITLGGDGTVLWAASMFKGPVPPIVPFSMGSLGFMTPFHSEQYRDCLEAVLKGPISITL
RHRLQCHIIRDKATNEYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVH
PQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFDGKDRKQLEAGDALVCSMAPWPVSTACQVESTNDF
LRSIHDGLHWNLRKTQSADGPRDT*

DNA
ATGGCAGAGAATGGTTTCAGTCATTTGACTTCACTTGCTCAATCAGAGAAGGCTGTTCAGGAGCTTCTTCTTCAGCAGAC
TCCTATGCAGGCTACTGACGACCATCTCATTGAGTTTTCAGAGGCTTTGAGAACTGTTGCAAAGGCACTAAGGGGAGCTG
CTGAAGGAAAGGCGTTGGCTCAAGCTGAGGCTGCTGAATGGAAGCGTCGATACGAGGTAGAGAGGTCGAAGAACGTAGAG
TTGCAGCATAAAGAACTGTCTAATGGAGTGTGTGCCGATGAATCTAATAGTCAAAGGATGGAGCACTTAGCAAAGTCTCC
GCGGCTTTATGCTCAGGAAATCAGTTCTAATGGCATGGAGCGTATTTGCTCTCATGAAGTGCTCCAAGATGGTGGATTTA
ACAGTTTTACTAACAAATTGAAGAGGAAGGCATCATTTAAACTTTCATGGGGATGTAAGGGGATGGCTAATGATCAACAC
AAAAAAGAAATTGTTTCGTTCGAGAGAGGGAATATCAGTACAGCAGAGCGCAGTAGTAAACAGATTTCACTGACATGGGA
GTCTGATCCACAAACTGTGCTTATTATCACTAAACCTAATTCAACTTCCGTGCGAGTTCTCTCTGTGGATATGGTCAGAT
GGTTGAGAACGCAAAAAGGACTAAATATTTATGTGGAACCTCGAGTAAAGGAAGAACTCTTATCAGAGTCAAGTTCCTTC
AACTTCGTACAAACTTGGGAAGATGACAAGGAAATTTCACTTCTACACACAAAAGTTGACCTTCTTATAACTCTTGGTGG
GGATGGCACAGTGCTATGGGCAGCATCGATGTTTAAAGGACCAGTGCCTCCAATTGTTCCATTCTCCATGGGATCTCTTG
GATTTATGACTCCTTTCCACAGCGAACAATACCGAGATTGTCTCGAAGCGGTTTTGAAAGGTCCAATCAGTATAACACTA
CGACACAGGTTGCAGTGTCACATCATCAGAGATAAAGCAACCAATGAATATGAAACAGAGGAGACTATGCTTGTTCTGAA
TGAAGTCACCATTGACCGTGGAATATCTTCTTACCTCACAAACCTTGAATGCTACTGCGACAACTCATTCGTCACATGTG
TGCAAGGCGATGGACTAATACTGTCTACAACATCTGGTAGCACCGCGTATTCACTTGCTGCTGGAGGGTCAATGGTCCAT
CCTCAGGTTCCTGGGATCTTATTCACGCCTATCTGTCCGCATTCTCTATCATTCCGCCCACTGATATTACCGGAACACGT
GACAGTGAGAGTGCAAGTGCCATTCAACAGCAGAAGCTCCGCTTGGGTCTCCTTTGATGGGAAAGACCGGAAACAGCTTG
AAGCAGGGGATGCACTAGTGTGTAGCATGGCACCATGGCCCGTCTCAACCGCTTGCCAAGTTGAATCCACCAACGACTTC
TTACGCAGCATCCACGATGGTCTTCACTGGAACCTAAGAAAGACTCAATCGGCTGACGGGCCTCGAGACACTTAG