Details for Lyrate rockcress Locus 16047346

Position : sca3 ( 5`- 5105288 .. 5107136 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047346

Protein [Map View]
MHKLSRSNRDKLQQFVAITGASEKNALQALKASDWHLEAAFDVFYSQPQPRSNAADVEPQDIVTLVLSWHMNAATACEFS
RQEFISGLQALGVDSIGKLHEKLPFMRSELKDEQKFHDIYNFAFGWAKEKGQKSLALDTAIGMWQLLFAERDWPLVTHWC
DFLQDRHNKAISKDTWAQLLEFARTVDPVLSNYDAEGAWPYLIDEFVEYLYDKNVVEK*

DNA
ATGCATAAGTTGAGTAGAAGCAACCGTGACAAACTTCAGCAGTTCGTGGCTATAACTGGAGCTAGCGAGAAGAATGCTCT
TCAGGCTCTCAAAGCTAGTGATTGGCACCTTGAAGCAGCGTTTGATGTGTTTTACAGCCAGCCCCAACCAAGAAGCAATG
CTGCTGATGTGGAACCCCAAGACATAGTCACGTTGGTTCTTTCGTGGCATATGAATGCTGCCACAGCGTGTGAATTTTCC
AGGCAAGAATTTATCAGTGGATTACAGGCATTAGGTGTAGATTCAATCGGGAAGTTGCACGAAAAGCTGCCATTTATGCG
TTCTGAGCTTAAAGATGAACAAAAGTTCCATGATATATACAACTTTGCTTTTGGGTGGGCGAAAGAGAAGGGGCAGAAAT
CTCTTGCCTTAGACACAGCGATTGGGATGTGGCAGTTGCTCTTTGCAGAAAGAGACTGGCCATTGGTAACTCACTGGTGT
GATTTCTTGCAGGATCGTCATAACAAGGCCATATCTAAGGACACATGGGCACAGCTCCTGGAATTTGCAAGGACGGTCGA
CCCGGTGCTGTCGAATTACGATGCTGAAGGAGCATGGCCTTACCTCATTGATGAATTCGTTGAGTATTTGTATGACAAGA
ATGTCGTTGAGAAGTGA