Details for Lyrate rockcress Locus 16047339

Position : sca3 ( 5`- 4596490 .. 4598352 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047339

Protein [Map View]
MTVVPSFVRNSAVASTSWNVRLRELAYQSLFTESISLYRSMLRSGSSPDAFSFPFILKSCASLSLPVSGQQLHCHVIRGG
CEAEPFVLTALISMYCKCGLVEDARKVFEENPHSSQLGVCYNALISGYTANSKVSDAAFMFRRMKETGVSVDSVTILGLV
PLCTVPEYLWLGRSLHGECVKGGTYSEVAVLNSFITMYMKCGSVESGRRLFDEMPVKGLITWNAVISGYSQNGLAYDVLE
LFEQMKSSGVCPDPFTLVSVLSSCAHLGAKKIGQEVGELVEANGFAPNVFLSNALISMYARCGNLAKARAVFDIMPVKSL
VSWTAMIGCYGMHGMGETGLTLFDDMIKRGIRPDGAVFVMVLSACSHSGLTDKGLELFRAMKREYKLEPGPEHYSCLVDL
LGRAGRLDEAMEFIDSMPVEPDGAVWGALLGACKIHKNVDMAELAFAKVIEFEPMNIGYYVLMSNIYSDSKNQEGIWRIR
VMMRERAFRKKPGYSYVEHKGKVHLFLAGDRSHEQTEEVHRMLDELETSVMELAGNMDCDRGEEVSSTTREHSERLAIAF
GILNSIPGTEILVIKNLRVCEDCHVFIKLVSKIVDRRFVVRDASRFHYFKDGVCSCKDYW*

DNA
ATGACCGTCGTTCCAAGCTTTGTACGGAACTCCGCGGTGGCTTCGACGTCATGGAACGTGCGTCTGAGAGAGCTCGCATA
TCAGTCATTGTTCACTGAATCTATCTCTCTTTACCGGTCAATGCTCCGTTCAGGTTCTTCTCCCGACGCGTTCTCTTTCC
CTTTCATTCTCAAGTCATGTGCTTCCCTTTCGCTCCCTGTCTCCGGCCAACAGCTCCATTGCCACGTGATCAGAGGAGGT
TGCGAAGCTGAGCCCTTTGTGCTGACGGCTCTGATCTCAATGTACTGTAAATGCGGTTTGGTAGAGGATGCACGCAAGGT
GTTCGAAGAAAATCCTCACTCAAGTCAGCTTGGTGTTTGTTACAACGCTTTGATATCTGGGTATACAGCAAACTCGAAGG
TCTCTGATGCTGCGTTTATGTTTCGTAGGATGAAGGAAACTGGCGTATCTGTGGATTCAGTTACAATACTTGGGCTTGTC
CCGCTTTGCACGGTTCCTGAATACCTCTGGCTTGGGAGGTCTCTTCACGGTGAATGTGTTAAAGGAGGAACATATTCTGA
AGTAGCTGTTTTGAATAGTTTCATCACAATGTACATGAAATGCGGGTCGGTAGAATCGGGTAGGAGGTTGTTCGATGAGA
TGCCTGTGAAGGGTTTGATTACCTGGAATGCTGTGATTTCTGGATATTCACAGAACGGGCTAGCTTACGATGTTCTGGAA
CTTTTTGAGCAGATGAAATCATCGGGTGTTTGTCCTGATCCTTTTACATTGGTTAGTGTTCTATCTTCTTGTGCCCATCT
TGGAGCTAAGAAGATTGGTCAGGAAGTAGGGGAGTTAGTAGAAGCCAATGGTTTTGCACCAAATGTGTTTTTAAGCAATG
CATTGATTAGTATGTATGCTAGATGCGGTAACTTGGCAAAGGCACGTGCTGTTTTCGACATCATGCCTGTAAAAAGCTTA
GTTTCATGGACCGCCATGATAGGTTGTTATGGGATGCATGGAATGGGAGAGACTGGGCTTACGCTTTTTGATGATATGAT
AAAAAGAGGCATAAGACCCGATGGAGCGGTGTTTGTAATGGTTTTATCTGCTTGCAGCCATTCAGGGCTAACCGATAAAG
GTTTAGAGTTATTTAGAGCGATGAAGAGAGAGTATAAGCTGGAGCCTGGTCCTGAACACTACTCTTGCTTAGTTGATCTA
CTCGGAAGAGCTGGTCGACTAGATGAAGCCATGGAGTTTATAGATTCAATGCCTGTTGAACCGGACGGTGCTGTTTGGGG
TGCTCTCTTGGGTGCATGTAAAATCCATAAGAATGTGGATATGGCAGAGTTAGCTTTTGCAAAGGTGATTGAGTTTGAAC
CCATGAACATTGGCTACTATGTATTGATGTCAAATATATATTCAGACTCGAAAAACCAAGAAGGAATCTGGAGAATCCGG
GTAATGATGAGAGAGAGAGCATTCAGGAAAAAGCCTGGGTATAGTTATGTGGAACACAAGGGAAAAGTTCACTTGTTTTT
AGCTGGCGATAGAAGTCATGAGCAAACAGAGGAAGTCCACAGAATGTTGGATGAGTTAGAGACTTCTGTGATGGAGCTTG
CGGGAAACATGGACTGTGATAGAGGCGAAGAGGTTTCGAGCACTACCCGTGAGCATAGCGAGAGGTTAGCAATAGCTTTT
GGGATTCTCAACAGTATTCCAGGCACAGAAATTCTCGTGATAAAGAATTTGAGGGTTTGTGAAGATTGTCATGTGTTTAT
CAAGCTGGTTAGCAAGATTGTAGATCGCCGGTTTGTTGTAAGAGATGCATCTCGGTTCCACTATTTCAAAGACGGGGTCT
GCTCGTGCAAAGATTACTGGTGA