Details for Lyrate rockcress Locus 16047318

Position : sca3 ( 5`- 4150229 .. 4141664 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897214 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047318

Protein [Map View]
MGIFNGLPVPSDKTYLREELARIDESWAAARFDSLPHVVHILTSKDREADIHILKEQSDVVEEVVDEVVHAYHGGFNKAI
QNYSQILRLFSESTEKIGDLKHDLAEAKQSLGARNKQLHQLWYRSVTLRHIISLLDQIEGIAKVPSRIEKLIADKQFYAA
IQVYLQSSLMLEREGLQTVGALQDVRSELTKLRGALFFKILDDLHAHLYNRGEYSSVASSIYERDDEVPTTTAVAASRMS
SQPLSRRTRTLKGDSQFGVRGLTNGSYRTGSNDESSSFDGHDEEDSVEHDESTADTARNGADSKLLSYQLPPWLSDSTPD
EFIEAIRKSDDPLHVKYLQTLVQCLCMLGKVAAAGAIICQKLRPTIHEIIISKIKAHMETTNLSKSACSQGDRNVAAGLH
FIKGQSEAYRLSKEKPQNGISNTGIHLAVSPVSPLMAPGGKAQTAAKELLDSILDTIVKIFENHVVIGELLELKASQHDI
NTPRSLPTDVNWNTESEASQATGGYTISFPLTVLQSECQQLICEILRATPEAASADSAAQTAKLAKKAPKKDKRDSPEDG
LTFTFRFTDATVSISNQGADLIRQGWGKRAPNASLEGYGSAAVLPEQGIYLAASIYRPVLQFTDKITSMLPKKHSQLVND
GLLTFTENFVKDHLLPTMFVDYRKGVQQAISSAAAFRPRAHTTTYTATVEKGRPILQGLLAIDLLAKEVLGWAQAMPKFA
TDLVKYVQTFLERTFERCRTSYMEAVLEKLSYMLIGRHDIEKLMRLDAASACLPSTLGHAVSHSEAVGTEVELSELFLSL
RPIKQDNLIRDDNKLILLASLSDSLEYVADSIERLGQAVPRVASQAEGNSRNQAASPRNLASFADEYRKLATDCLKVLRV
EMQLETVFHLQEMTNREYLEDEDAEEPDDFVISLTSQITRREEGMAPFISGEKRNYVFGGICGIAANASIKALADMRSIN
LFGVQQICRNTIAVEQAMAAIPYIDGETVQQNLDRVRTYFELLNMPFEALLAFIAEHDQMFTPTEYSNLLKVNVPGRDTP
SDAQSRLLEILSH*

DNA
ATGGGGATTTTCAATGGTTTGCCTGTACCCTCGGATAAAACTTACCTTAGGGAGGAGCTGGCAAGAATAGATGAGAGCTG
GGCTGCTGCACGATTTGACTCTTTGCCACATGTTGTGCATATTTTGACATCAAAAGACCGTGAAGCTGACATTCATATAT
TAAAGGAACAAAGTGATGTTGTCGAGGAGGTTGTAGATGAAGTTGTCCACGCTTATCATGGTGGTTTCAACAAGGCCATT
CAAAACTATTCCCAGATCTTGCGATTATTCAGTGAGTCCACTGAAAAGATAGGCGACTTGAAGCACGATTTAGCAGAAGC
GAAGCAGAGCTTGGGTGCACGCAACAAACAATTACATCAGTTGTGGTACCGTTCTGTTACATTGCGGCACATCATCTCAC
TTTTGGATCAAATCGAGGGCATTGCTAAGGTTCCATCTCGTATTGAGAAGCTCATTGCTGATAAGCAGTTTTACGCTGCT
ATTCAAGTTTATCTCCAGTCGTCTCTGATGCTGGAGCGTGAGGGGCTTCAAACGGTTGGTGCTCTTCAAGATGTCAGATC
TGAGCTAACTAAGTTGCGGGGAGCCCTTTTCTTCAAAATTCTAGATGATTTGCATGCACACCTATACAATAGAGGTGAAT
ACAGTTCAGTTGCGTCAAGCATATATGAAAGAGATGATGAAGTACCAACAACAACAGCTGTTGCAGCTAGTCGAATGAGC
TCACAACCACTGTCTCGTAGAACACGGACGCTGAAAGGTGATAGTCAGTTTGGTGTTAGAGGGCTTACAAATGGTTCATA
TAGAACCGGTTCTAATGATGAAAGTTCATCATTTGATGGACATGATGAAGAGGACTCCGTAGAACATGATGAATCCACCG
CAGATACTGCCAGGAATGGCGCTGATAGTAAATTGCTTTCTTACCAACTTCCGCCATGGCTTTCTGATTCCACTCCTGAC
GAGTTTATTGAAGCAATAAGAAAGAGTGATGATCCACTGCATGTGAAGTATCTTCAGACCCTTGTTCAGTGTCTATGCAT
GCTTGGAAAAGTTGCAGCTGCGGGTGCTATCATATGCCAAAAACTTCGACCCACAATTCATGAGATCATAATATCCAAGA
TTAAAGCCCATATGGAGACTACAAATTTGTCAAAGTCCGCGTGTAGTCAGGGTGATCGAAATGTAGCTGCCGGATTGCAT
TTTATCAAAGGACAGTCGGAGGCCTACAGGTTATCAAAAGAGAAACCTCAAAATGGGATATCAAATACAGGAATTCACTT
GGCTGTGAGCCCTGTTTCGCCTCTTATGGCTCCTGGAGGCAAAGCGCAGACTGCAGCAAAAGAACTTCTTGACTCAATTT
TAGATACTATTGTCAAGATATTTGAAAATCATGTTGTTATTGGAGAGCTTTTGGAGTTGAAGGCTTCGCAACATGACATT
AACACTCCAAGGTCATTACCTACTGATGTGAACTGGAACACCGAGTCTGAAGCATCCCAAGCTACTGGAGGCTACACTAT
CAGTTTTCCCTTGACAGTCTTACAGAGTGAATGCCAACAACTCATATGTGAAATTCTACGAGCAACCCCAGAAGCTGCTT
CAGCAGATTCTGCTGCACAAACTGCTAAGCTTGCAAAGAAGGCTCCAAAGAAAGACAAAAGGGATTCACCTGAAGATGGG
CTAACATTCACCTTTCGGTTTACAGATGCAACTGTATCGATTTCTAATCAGGGAGCTGATCTCATTCGTCAAGGCTGGGG
AAAGAGGGCTCCAAATGCATCACTGGAAGGTTATGGATCCGCAGCTGTTTTGCCTGAACAAGGAATATATCTAGCTGCAT
CTATTTACCGGCCTGTCCTTCAGTTTACAGATAAAATCACTTCAATGTTGCCCAAAAAGCATTCCCAACTTGTGAATGAT
GGATTGCTTACATTCACTGAGAACTTTGTAAAGGACCATCTGTTACCGACAATGTTTGTGGACTATAGGAAAGGCGTACA
GCAAGCTATATCAAGCGCTGCCGCATTTCGGCCCCGTGCACATACAACTACTTACACTGCAACCGTAGAAAAGGGTCGAC
CTATCTTACAAGGTCTTTTGGCAATAGATCTCCTTGCAAAAGAGGTTCTTGGCTGGGCTCAAGCCATGCCTAAATTTGCT
ACTGACCTTGTGAAGTATGTTCAGACATTTCTTGAGAGGACATTTGAGAGATGTCGAACATCATACATGGAGGCTGTTCT
AGAGAAGCTCAGTTACATGCTCATTGGGAGGCATGATATTGAGAAATTGATGCGGCTTGATGCGGCGAGTGCTTGTTTGC
CATCTACGCTTGGCCATGCCGTTTCTCACTCTGAGGCTGTTGGCACTGAAGTAGAACTCAGTGAACTATTCTTGAGTTTG
CGACCTATCAAGCAGGATAATCTAATTCGTGATGACAACAAACTGATTTTGTTAGCTTCTCTCAGTGACTCACTTGAATA
CGTGGCAGACTCTATTGAGAGGCTTGGACAAGCAGTTCCTCGTGTGGCAAGTCAAGCTGAAGGTAATAGCAGAAATCAAG
CAGCTTCTCCTAGGAATCTGGCATCATTTGCTGATGAGTACAGAAAACTTGCGACTGATTGCCTAAAGGTTCTTCGTGTT
GAGATGCAATTGGAAACAGTCTTTCATCTTCAGGAAATGACGAATAGGGAATACTTGGAGGATGAAGATGCTGAAGAGCC
GGATGACTTTGTGATATCTCTTACTTCACAGATAACACGTAGGGAGGAGGGAATGGCGCCTTTCATCTCTGGTGAGAAGC
GTAATTACGTTTTTGGTGGCATATGTGGAATTGCAGCAAATGCGTCCATTAAGGCTTTGGCTGACATGAGATCAATCAAC
CTTTTCGGGGTTCAACAAATATGTCGGAACACTATTGCAGTGGAACAGGCCATGGCAGCTATTCCATATATCGATGGTGA
AACCGTACAACAGAACCTAGATCGTGTCCGTACTTACTTTGAACTGTTAAACATGCCATTCGAAGCATTGCTCGCTTTCA
TAGCAGAACACGACCAAATGTTTACACCCACAGAGTATTCCAATCTTCTGAAGGTCAATGTTCCTGGAAGAGATACCCCT
TCAGATGCTCAATCACGCCTTTTGGAAATTCTTTCTCACTAA