Details for Lyrate rockcress Locus 16047284

Position : sca3 ( 5`- 10730666 .. 10731439 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047284

Protein [Map View]
MTSPMKGLLKGLRYIARIFEDEKEPEMQIGIPTDVKHVAHIGWEGPSATTPSWMHDFKSQDRTKTETKGSSNKKPGSSGE
KHRNKGRRKTSTGNNSPAESPSRVGGSVRQSRRSTGKQREQNTGSGSESGSGLELPQQTEQSVGPKHSRQKKSKGSAAGG
GGGGGEPPPAIEHVKTKETDISVRAVYPCAGLGSSTGR*

DNA
ATGACCTCACCAATGAAGGGTCTATTAAAAGGGTTGAGGTACATTGCTCGTATCTTCGAGGATGAGAAGGAACCAGAGAT
GCAGATTGGAATACCGACCGATGTAAAACATGTTGCTCATATAGGATGGGAAGGGCCCTCTGCTACAACCCCAAGCTGGA
TGCATGATTTCAAGTCTCAAGATCGCACGAAGACTGAGACAAAGGGAAGCTCTAACAAGAAACCTGGGAGTTCCGGGGAG
AAGCATAGGAACAAGGGAAGGCGTAAAACATCCACAGGAAACAACTCACCAGCAGAATCTCCATCAAGGGTAGGAGGATC
AGTGAGGCAATCAAGACGCAGCACGGGCAAACAGAGAGAACAGAACACGGGTTCGGGGTCAGAGTCAGGGTCAGGGTTAG
AGTTACCTCAACAGACTGAACAGTCTGTTGGACCAAAACACTCAAGACAGAAAAAATCAAAAGGATCAGCAGCAGGAGGA
GGAGGAGGAGGAGGCGAACCTCCTCCAGCTATTGAACATGTAAAGACGAAAGAAACAGATATATCCGTGAGAGCGGTATA
CCCTTGTGCGGGTCTTGGAAGTTCTACAGGAAGATGA