Details for Lyrate rockcress Locus 16047275

Position : sca1 ( 5`- 7642318 .. 7640701 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047275

Protein [Map View]
MAEESYDEECDYLFKAVLIGDSAVGKSNLLSRFSRDEFRLDSKPTIGVDFAYRNVRVGDKTIKAQIWDTAGQERFRAITS
SYYRGALGALLIYDITRRITFKNIGKWLSELRGFSSPETVVVLVGNKSDLGQSREVEEEEGKTLAESEGLYFLETSALEN
QNVEEAFLSMIGRIHEVLTQKTAVDNRPNGDGNNESNGAVIPPSKEIVNIHEFTATRPLSTSLPNCCYK*

DNA
ATGGCGGAGGAATCGTATGACGAAGAGTGCGACTACCTATTCAAGGCGGTGCTGATAGGAGACTCTGCCGTCGGAAAATC
AAACCTCTTGTCGAGATTCTCGAGGGATGAGTTTCGGTTAGACTCTAAACCGACCATCGGAGTAGACTTTGCTTACCGGA
ATGTTCGGGTGGGTGATAAGACTATCAAGGCTCAGATATGGGACACCGCCGGCCAAGAAAGATTTAGAGCAATAACGAGT
TCGTATTACCGTGGAGCCTTGGGAGCTTTACTAATCTACGACATCACAAGACGAATCACTTTCAAAAACATTGGAAAATG
GTTGTCGGAGCTCAGAGGCTTCTCTAGTCCTGAGACCGTCGTTGTTCTCGTAGGTAACAAATCCGATCTCGGGCAGTCTA
GAGAAGTTGAAGAAGAAGAGGGTAAGACACTAGCCGAATCAGAAGGTCTCTATTTTCTCGAAACATCAGCTTTAGAGAAC
CAAAATGTTGAGGAAGCGTTTCTAAGCATGATCGGACGGATACATGAGGTTTTGACTCAGAAGACCGCGGTAGACAATAG
ACCCAACGGTGACGGTAACAACGAAAGTAACGGTGCGGTCATTCCCCCCAGTAAAGAGATTGTGAATATTCATGAATTTA
CCGCCACTCGACCGTTGAGTACTTCTTTGCCCAATTGTTGCTACAAGTAA