Details for Lyrate rockcress Locus 16047273

Position : sca3 ( 5`- 8595284 .. 8601095 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047273

Protein [Map View]
MEGENTTEQPYTTAASSGQSIFVRPPPIAPVLATASNVSQSEQPSMSIASTGFVSQSVPSSVAAQWASNAAASSNVNPIP
QASPMLANAPFGRPGKLAPPGLMTSPPAFPGSNPFSTTPRPGMSTGPAQINPSIHPHMYPPYHSLPTMPGTPQGMWLQPP
LMGGIPRAPFISHPTTFPGSYPFPVRGISPNLPYSGSHPLGAIPMGSVGNVHALPGHQLDISPGQKTEALSGIDDRAGSQ
LVGNQLDAWTAHKSEAGVVYYYNSVTGHSTYEKPPGFGGEPDKVPVQPIPVSMEDLPGTDWALVSTNDGKKYYYNNKTKV
SSWQIPAEVKDLGKKPEERAMESVASVPSADFTEKGSDLSSLSAPAISNGGRDAASLKTTNFGSSALDLVKKKLHDSGVP
VSSTTTSEANGGKASEVTPSGESGNGTGKIKDAPGAGELSDSSSDSEDEDSGPSKEECFKQFKEMLKERGIAPFSKWEKE
LPKIIFDPRFKAIPSHSVRRSLFEQYVKTRAEEERREKRAAHKAAIEGFRQLLDEASTDIHQHTDYRAFKKKWGNDLRFE
ALERKEREALLNERVLSLKRTAEQKAQEIRAAAASDFKTMLHEREVSLNSHWSKVKDSLRNEPRYRSVAHEDREFFYYEY
IAELKAAQRGDDHEMKARDEADKLRERERELRKRKEREVQEVERVRQKIRRKEASSSYQALLVEKIRDPEASWTESKPKL
ERDPQKRASNPDLDPADKEKLFRDHIKTLYERCVHDFKALLVEALSSEAASQQTEDGKTVLDSWSAAKQVLKPDIRYSKM
PRRDREVLWRRYAEDIWRKQKQENYQEEKQRDYKT*

DNA
ATGGAAGGGGAGAATACAACGGAGCAGCCGTACACGACGGCGGCATCTTCGGGACAGAGTATCTTCGTCCGTCCTCCTCC
AATTGCTCCAGTATTGGCTACTGCTTCGAATGTCTCTCAGTCGGAGCAACCCTCTATGTCTATTGCTAGTACAGGTTTTG
TCTCTCAGTCAGTTCCATCTTCTGTTGCTGCACAATGGGCTTCTAATGCAGCAGCCTCCTCAAATGTTAATCCCATACCT
CAAGCTTCGCCCATGCTAGCAAATGCACCTTTTGGTCGACCAGGAAAACTCGCCCCTCCTGGACTAATGACATCTCCGCC
TGCTTTTCCTGGTTCCAATCCCTTTTCTACTACTCCAAGACCTGGGATGTCTACAGGTCCTGCTCAAATCAATCCTAGTA
TTCATCCGCACATGTATCCTCCATATCATTCACTGCCTACAATGCCTGGAACGCCTCAAGGAATGTGGTTGCAGCCTCCT
CTTATGGGTGGTATTCCCAGGGCACCTTTTATTTCACATCCTACTACTTTTCCTGGTTCATATCCATTTCCAGTTCGTGG
AATCTCTCCTAACCTACCATATTCTGGTTCTCACCCGCTTGGTGCCATTCCTATGGGAAGTGTTGGCAATGTTCATGCAT
TACCAGGTCATCAGCTTGATATATCTCCCGGGCAAAAGACAGAAGCACTCTCAGGAATCGATGACAGAGCTGGTTCTCAA
CTAGTTGGAAATCAGTTAGATGCCTGGACTGCACATAAATCAGAAGCAGGAGTTGTTTATTATTATAATTCCGTTACAGG
GCATTCAACCTACGAAAAGCCTCCTGGTTTTGGAGGGGAGCCTGATAAAGTGCCAGTGCAGCCAATTCCAGTTTCTATGG
AGGATTTACCTGGGACAGATTGGGCTCTTGTGTCCACAAATGACGGCAAAAAGTATTACTACAACAATAAAACAAAGGTC
AGCAGCTGGCAAATTCCTGCAGAAGTGAAAGATTTGGGGAAGAAACCGGAGGAGAGGGCTATGGAGAGTGTAGCATCTGT
GCCAAGTGCTGATTTCACTGAAAAAGGTTCTGATCTATCAAGTTTGAGCGCACCTGCTATCAGCAATGGTGGCCGGGATG
CTGCATCTCTAAAAACTACAAATTTTGGCTCGTCGGCACTGGATTTGGTTAAAAAGAAACTACATGATTCTGGAGTGCCC
GTCTCATCTACGACAACATCTGAAGCAAATGGTGGTAAAGCAAGTGAGGTCACACCAAGTGGAGAAAGTGGAAATGGTAC
GGGTAAGATAAAAGATGCTCCTGGAGCTGGGGAACTTTCTGATTCTTCTTCAGATTCCGAAGATGAAGATAGTGGACCAT
CGAAGGAAGAGTGCTTTAAACAGTTTAAGGAAATGCTGAAAGAGAGAGGAATAGCACCGTTTTCTAAATGGGAGAAGGAA
TTGCCAAAAATTATCTTTGACCCTCGCTTTAAGGCAATACCAAGTCATTCTGTTAGAAGATCTTTATTTGAGCAGTACGT
AAAGACACGCGCTGAGGAAGAACGTAGGGAAAAGCGTGCTGCTCATAAGGCAGCTATTGAAGGTTTCAGGCAGTTGCTGG
ATGAAGCGTCTACGGACATCCATCAACACACTGATTATCGTGCTTTTAAAAAGAAATGGGGGAATGATCTCCGGTTCGAA
GCACTTGAGCGGAAGGAGCGGGAGGCTTTGCTGAATGAAAGGGTCCTTTCTTTGAAACGAACTGCTGAACAAAAGGCGCA
AGAAATTCGCGCAGCTGCTGCCTCTGATTTCAAGACAATGCTACACGAAAGAGAAGTATCATTGAATTCACATTGGTCCA
AGGTGAAGGATAGTCTGAGAAATGAACCACGATATAGATCTGTTGCACACGAGGACAGGGAGTTTTTTTATTATGAGTAC
ATTGCAGAACTAAAAGCTGCACAAAGGGGAGATGATCATGAGATGAAAGCCAGAGACGAAGCGGACAAACTGAGGGAACG
GGAGCGTGAGTTGCGGAAACGCAAAGAAAGAGAAGTGCAAGAGGTGGAAAGAGTACGACAAAAAATTAGAAGGAAAGAGG
CAAGCTCCTCTTATCAAGCTTTGTTAGTGGAAAAAATCAGAGACCCTGAGGCATCCTGGACGGAATCTAAGCCAAAACTT
GAGAGGGATCCTCAAAAACGGGCCTCTAATCCAGACTTGGATCCTGCTGATAAAGAGAAGCTATTCCGAGACCACATAAA
GACATTATATGAGCGATGTGTTCATGACTTCAAAGCTCTTCTAGTTGAAGCCTTGTCATCTGAAGCTGCTTCTCAACAAA
CAGAAGACGGAAAGACTGTGCTTGATTCTTGGTCAGCAGCTAAACAAGTACTGAAACCCGATATCAGGTACAGCAAGATG
CCAAGGAGAGATAGGGAAGTCTTATGGCGCCGATATGCTGAGGATATCTGGAGGAAACAGAAACAAGAAAACTATCAGGA
GGAGAAACAAAGAGATTATAAGACATAA