Details for Lyrate rockcress Locus 16047270

Position : sca3 ( 5`- 3315491 .. 3317804 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047270

Protein [Map View]
MSSPGTSMFTNFTKLCKGLALVLVVGHLVVQFIPATVPYLALIPARTIPFAWNLITSGYFELSVYGVVFSTVSLLFMGKF
LEPVWGSKEFLKFIFVVNFLAYLCVFVTAIALYYITRLEIYLYMPFAGFHGVLAGLLVGIKQIIPDQEILLLKIKAKWLP
SIMLILSIASSFFTLNSAAYLPTLIFGTYMGWLYLRYLQRRPETKLRGDPSDDFAFSTFFPEFLRPVIDPIALIFHRMLC
GRSNATSEDHGYSTSGAPLPGSDSAEASRRRERGARALEERLGTERLVPARNKDELQSDALDSV*

DNA
ATGAGTTCTCCGGGAACGAGTATGTTCACCAATTTCACTAAGCTCTGCAAAGGACTTGCTCTGGTGCTTGTGGTGGGACA
CCTCGTGGTTCAGTTCATTCCCGCTACCGTCCCATACCTTGCTCTGATTCCGGCGAGGACTATTCCTTTTGCCTGGAATC
TGATAACAAGCGGCTATTTTGAACTCTCAGTATATGGGGTTGTCTTCAGCACCGTTTCTCTCCTCTTTATGGGGAAGTTT
CTGGAACCTGTCTGGGGTTCCAAGGAGTTCCTTAAGTTCATCTTTGTGGTGAACTTCCTTGCGTATCTCTGTGTCTTCGT
TACAGCCATTGCCTTATACTACATAACGAGGCTGGAAATTTACCTATATATGCCCTTTGCCGGTTTTCATGGTGTCTTGG
CAGGCCTTCTTGTCGGGATAAAGCAGATAATTCCTGACCAGGAGATATTGCTGTTAAAGATAAAAGCAAAGTGGTTGCCC
TCAATTATGCTAATTTTGTCAATAGCCTCAAGCTTCTTCACACTAAATTCAGCAGCATATCTTCCCACTTTGATATTTGG
TACATATATGGGCTGGTTATACCTCAGGTACCTACAGAGGAGACCAGAAACAAAGCTCAGAGGTGATCCAAGTGATGACT
TTGCCTTCTCTACTTTCTTCCCTGAATTTCTCAGGCCCGTAATCGACCCTATTGCCTTAATCTTTCACCGGATGCTTTGT
GGACGATCAAATGCCACCAGTGAAGACCATGGTTATTCTACCAGCGGTGCGCCATTGCCAGGTTCTGATTCTGCTGAAGC
ATCTAGGAGGAGAGAAAGAGGGGCAAGAGCTCTAGAGGAGAGACTAGGAACGGAAAGATTGGTTCCTGCAAGGAACAAAG
ATGAATTGCAGAGTGATGCTTTGGATAGTGTATAA