Details for Lyrate rockcress Locus 16047251

Position : sca3 ( 5`- 1630511 .. 1629929 -3` )
Annotation : [B2G] pr4-type protein
External links : CoGe
PGDD synteny : 16047251

Protein [Map View]
MARLSICLFVLLCTFAAKAAAQTASNVRATYHYYYPEQNGWDLYKVSAYCSTWKGNQPIEWRRKYGWTAFCGPTGPRGRD
SCGRCLRVTNTATGTQATVRIIDQCSNGGLDLDDGVFRQLDTNGQGYARGHLIVNYEFVNC*

DNA
ATGGCAAGACTTAGCATATGTTTGTTTGTTTTGCTATGCACATTTGCGGCTAAAGCAGCCGCTCAAACCGCTTCTAATGT
AAGAGCAACTTACCATTACTATTATCCCGAGCAAAACGGTTGGGACCTTTACAAAGTAAGTGCGTATTGCTCAACATGGA
AAGGAAACCAACCTATCGAATGGCGTAGGAAGTACGGTTGGACAGCTTTCTGCGGTCCAACTGGACCGCGAGGCCGTGAT
TCTTGCGGAAGATGCTTAAGAGTAACGAATACTGCGACGGGAACACAAGCGACGGTGAGAATCATTGATCAGTGTAGTAA
CGGCGGTTTAGACTTAGACGACGGCGTTTTCAGGCAACTTGATACTAACGGTCAGGGATACGCACGTGGGCACTTAATTG
TCAACTACGAATTTGTCAATTGCTGA