Details for Lyrate rockcress Locus 16047241

Position : sca3 ( 5`- 10128641 .. 10127757 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047241

Protein [Map View]
MSLEEDIVSDDEMNMIDEDSATDSEAESLSDSDTENEITEKLAEPTKTAVYNRDGLLDKLQDISWPEDVDWTHKLTVEID
QGQAVDVNDDLAREMAFYTQALEGTREAFGKLNEMGVNFLRPANYYAEMVKSDIHMEKVKSRLLHEKKQIEESEERRKAR
DNKRMAKEVQSQKMKERAKQKKDDIESVKKWRKQRQQSGFSDEAGAPELDFESGKSFQRGGGKKRPGVSPGDRSGGKGRP
TSRMSNKKREFRDSKFGHGGRKGLSKQNTAETTNDFRGGFRGGRASGNNKRQKR*

DNA
ATGTCGCTGGAAGAGGATATAGTATCAGATGATGAGATGAACATGATTGATGAGGATAGTGCTACTGACTCTGAAGCGGA
ATCGCTTTCGGATTCGGATACAGAGAACGAGATAACGGAGAAATTGGCTGAGCCTACGAAGACTGCTGTATACAACAGAG
ATGGGTTGCTTGATAAACTTCAAGATATTAGCTGGCCTGAAGATGTTGATTGGACTCATAAGCTTACTGTTGAGATTGAT
CAGGGACAAGCTGTGGATGTGAACGATGACCTTGCGAGGGAGATGGCCTTCTATACTCAAGCTCTTGAAGGGACGAGAGA
AGCGTTTGGGAAACTCAATGAAATGGGTGTGAATTTCCTCAGGCCGGCGAATTACTATGCTGAGATGGTGAAATCGGATA
TTCATATGGAGAAAGTGAAGTCTCGGCTTTTGCATGAGAAGAAACAGATTGAGGAGTCTGAAGAGAGGAGGAAGGCTAGG
GATAATAAGAGAATGGCTAAGGAAGTACAGTCTCAGAAGATGAAGGAACGTGCGAAGCAGAAGAAGGATGACATTGAGTC
TGTGAAGAAGTGGAGGAAACAGAGGCAGCAGAGTGGGTTTAGTGATGAAGCGGGTGCGCCTGAACTTGATTTCGAAAGCG
GAAAGAGTTTCCAGAGGGGAGGAGGTAAGAAAAGACCAGGTGTTTCTCCCGGGGATCGATCAGGAGGCAAAGGAAGGCCT
ACTTCGAGGATGAGCAACAAAAAGAGGGAGTTTCGCGATTCAAAGTTTGGTCATGGTGGTAGGAAGGGTTTGAGCAAGCA
GAACACAGCAGAGACAACGAATGATTTCAGGGGCGGATTTCGTGGTGGAAGAGCCAGCGGAAACAACAAGAGGCAGAAGA
GGTAA