Details for Lyrate rockcress Locus 16047239

Position : sca3 ( 5`- 3618344 .. 3613503 -3` )
Annotation : [B2G] mrna capping enzyme family protein
External links : CoGe
PGDD synteny : 16047239

Protein [Map View]
MDLNASPQPEEDDEPYVRHLEDYNSRDDRIESAVEIARRVREERKKRMRYDKPTHNSQPVFRDQYYQNRNTKAYDRYKIP
QGWLDCPPSGHEIGFLVPSKVPLNESYNNHVPPGSRYSFKQVIHSQRIAGRKLGLVIDLTNTTRYYSTTDLKKEGIKHVK
IACKGRDSVPDNVSVNAFVNEVNQFVLNLKHSKKYILVHCTHGHNRTGFMIVHYLMRSLPMNVTQALKIFSDARPPGIYK
PDYIDALYSFYHEIKPESVICPSTPEWKRSTELDLNGEALPEDDDDDGGPAGPVQCFQEESHPVDVKMSNDDVLGDEIPP
DQEEGYRQFFYKMLSLNIGGRGCSQFPGSHPVSLNRENLQLLRQRYYYATWKADGTRYMMLLTIDGCYLVDRSFRFRRVQ
MRFPFRHPTEGISDKVHHYTLLDGEMIIDTLPDKQKQERRYLIYDMVAINGQSVVERPFYERWKMLEKEVIDPRNHEKAR
SHIYRYDLEPFRVRRKDFWLLSAVEKVLKGFIPSLSHEADGLIFQGWDDPYVPRTHEGLLKWKYPEMNSVDFLYEQDESG
RGMLSLFERGKKKHMDGNSVVFRDDSDPAEYSGKIVECSWDQDEKVWVSMRVRVDKSTPNDINTYRKVMRSIKDNITEEV
LLQEIREIIRLPMYADRIQMDSKAARRR*

DNA
ATGGACTTAAATGCTTCACCCCAACCCGAAGAAGATGACGAACCCTATGTCAGACATTTAGAAGATTATAATTCTCGGGA
TGACCGGATAGAGTCTGCTGTTGAAATCGCAAGACGGGTACGTGAAGAGAGAAAGAAACGAATGAGATATGACAAGCCAA
CACATAACTCGCAGCCAGTTTTCCGTGATCAATATTATCAGAATCGAAATACTAAAGCTTATGATAGATACAAGATCCCT
CAAGGTTGGCTAGACTGCCCTCCTTCTGGGCATGAGATAGGATTCCTTGTTCCTTCCAAAGTTCCCCTGAATGAATCTTA
CAATAATCATGTACCTCCTGGAAGTAGATACTCTTTTAAACAGGTGATCCATAGCCAGAGGATAGCTGGGAGAAAGCTTG
GTCTGGTGATCGATTTGACAAACACAACTCGTTACTATTCTACGACAGACTTGAAGAAAGAAGGCATTAAGCATGTGAAG
ATTGCATGCAAGGGTCGTGATTCAGTGCCAGATAATGTGTCTGTCAACGCGTTTGTCAATGAGGTTAATCAGTTCGTCCT
AAATCTAAAACACTCGAAAAAGTATATTCTCGTCCACTGTACACATGGGCATAATCGGACAGGGTTTATGATAGTTCATT
ATCTTATGCGATCTTTGCCAATGAATGTTACACAGGCATTGAAAATCTTTTCTGATGCCCGACCACCTGGGATCTATAAA
CCTGATTATATTGATGCTTTATACTCGTTTTATCACGAAATAAAACCTGAAAGCGTCATTTGCCCATCAACTCCTGAATG
GAAGAGGTCGACTGAACTTGATTTAAACGGTGAAGCTTTGCCAGAGGATGATGATGATGATGGCGGTCCAGCTGGTCCTG
TGCAATGTTTTCAGGAGGAAAGTCATCCGGTGGATGTCAAGATGTCAAATGATGACGTTCTAGGTGATGAAATTCCCCCT
GACCAGGAGGAAGGTTACCGGCAATTCTTTTATAAGATGCTATCACTGAATATTGGGGGAAGAGGATGTTCACAATTTCC
CGGTTCACACCCTGTCTCCTTAAACAGGGAAAATTTGCAACTCTTGAGGCAGCGGTACTATTATGCAACATGGAAAGCTG
ATGGAACGCGATATATGATGCTGCTAACCATAGATGGATGCTATCTAGTAGATAGGAGCTTTAGATTCCGGAGGGTACAG
ATGCGGTTCCCCTTCAGGCACCCAACTGAAGGCATATCTGATAAAGTGCACCATTACACATTGCTTGATGGAGAAATGAT
AATCGATACCTTGCCAGATAAACAAAAGCAGGAGAGGAGATACCTAATCTATGACATGGTAGCAATCAACGGCCAATCAG
TTGTAGAGAGGCCTTTCTATGAAAGATGGAAGATGCTCGAGAAGGAGGTGATAGACCCCCGTAATCATGAGAAGGCCAGA
AGTCATATCTACAGATATGACCTTGAGCCTTTTAGGGTACGGAGAAAGGATTTTTGGTTGCTTTCTGCGGTTGAGAAGGT
TTTGAAGGGTTTCATACCATCACTTTCACATGAAGCCGACGGCCTAATCTTTCAGGGCTGGGATGATCCTTATGTTCCCC
GCACCCATGAAGGTCTGTTGAAGTGGAAGTATCCAGAGATGAACTCGGTTGACTTTCTATACGAGCAGGATGAGAGTGGC
CGTGGAATGCTCTCCTTGTTTGAAAGAGGGAAGAAAAAGCATATGGATGGGAATTCTGTTGTTTTTAGAGATGATTCAGA
CCCTGCCGAGTACTCTGGGAAGATTGTAGAGTGTTCTTGGGATCAGGATGAGAAAGTCTGGGTAAGCATGCGGGTCAGGG
TCGATAAATCAACGCCAAATGATATCAACACATACAGAAAGGTGATGAGAAGCATAAAGGACAACATTACAGAGGAAGTG
TTGCTGCAGGAGATAAGGGAGATCATCCGTTTGCCTATGTATGCGGACCGTATTCAAATGGATAGCAAAGCTGCGCGTCG
CAGATGA