Details for Lyrate rockcress Locus 16047231

Position : sca3 ( 5`- 6387985 .. 6389412 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897803 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047231

Protein [Map View]
MAEMKCVGVVGAGQMGSGIAQLAATSGLDVWLMDADRDALSRATAAISSSVKRFVSKGLISKEIGDDAMHRLRVTSNLED
LSSADIIVEAIVESEDIKKKLFKDLDGIAKSCAILASNTSSISITRLASATKRPSQVIGMHFMNPPPIMKLVEIIRGADT
SEETFIATKALAERFGKTTVCSQDYAGFIVNRILMPMINEAFHTLYTGVATKEDIDSGMKHGTNHPMGPLELADLIGLDV
CLSVMKVLHEGLGDSKYAPCPLLVQYVDAGRLGRKRGVGVYDYRKATQKPSPRL*

DNA
ATGGCGGAGATGAAGTGTGTCGGAGTAGTTGGTGCTGGACAGATGGGTTCAGGAATCGCACAACTCGCCGCCACGAGTGG
CCTCGATGTTTGGCTCATGGACGCTGATCGAGATGCGCTCTCTCGAGCCACCGCAGCTATCTCCTCCTCCGTCAAACGTT
TCGTCTCCAAAGGTCTAATCTCCAAGGAAATTGGTGATGATGCTATGCATCGTCTACGTGTAACATCGAATCTTGAAGAT
TTGTCTTCTGCTGATATCATTGTTGAAGCCATTGTGGAATCAGAAGACATTAAGAAGAAACTGTTCAAGGATTTAGATGG
TATAGCCAAGAGTTGTGCGATTTTAGCTTCTAACACAAGTTCTATCTCCATTACTCGTCTTGCATCTGCAACGAAAAGAC
CAAGCCAGGTCATTGGAATGCACTTTATGAACCCTCCTCCAATAATGAAACTGGTTGAGATCATTCGTGGTGCAGATACC
TCAGAAGAGACGTTTATTGCTACAAAAGCTCTGGCTGAAAGGTTTGGCAAGACAACAGTCTGTTCACAAGACTATGCGGG
CTTCATTGTGAACAGGATCCTCATGCCTATGATCAATGAAGCGTTCCACACACTTTACACAGGGGTAGCTACAAAGGAAG
ACATAGACAGCGGAATGAAACACGGCACAAACCACCCGATGGGTCCTCTGGAGTTGGCGGACTTAATCGGTCTAGACGTG
TGCTTGTCCGTAATGAAAGTGCTGCACGAGGGACTTGGGGACTCAAAGTACGCACCTTGCCCTCTTCTTGTTCAATACGT
TGATGCGGGAAGATTAGGAAGAAAACGAGGAGTAGGAGTTTATGATTACCGTAAAGCTACACAGAAGCCATCTCCTCGGC
TCTGA