Details for Lyrate rockcress Locus 16047202

Position : sca3 ( 5`- 2198901 .. 2200852 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477864 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047202

Protein [Map View]
MATRNRTLLFRKYRSSLRSVRAPMGSSSSSTVTEHTSLTGAKSGLGPVIEMASTSLLNPNRSYAPVSTEDPGNSSRGTIT
VGLPPDWVDVSEEISVYIQRARTKMAELGKAHAKALMPSFGDGKEDQHQIESLTQEITFLLKKSEKQLQRLSAAGPSEDS
NVRKNVQRSLATDLQNLSMELRKKQSTYLKRLRLQKEDGSDIEMNLNGSSYNAEDDDFDDMVFSEHQISKIKKSEEISVE
REKEIQQVVESVSELAQIMKDLSALVIDQGTIVDRIDYNIQNVASTVDDGLKQLQKAERTQRQGGMVMCASVLVILCFIM
LVLLILKEILL*

DNA
ATGGCGACTAGGAATCGTACGCTGTTGTTTAGGAAGTACAGAAGCTCTCTAAGGAGCGTTCGTGCTCCAATGGGGTCGTC
TTCGTCGTCGACGGTAACGGAGCACACTTCGTTGACCGGAGCTAAATCCGGCTTAGGCCCGGTGATCGAGATGGCGAGCA
CGTCTCTATTGAATCCGAATCGGTCTTATGCTCCAGTCAGTACCGAGGATCCTGGTAATTCGAGTAGAGGTACAATAACA
GTGGGATTACCACCAGATTGGGTTGATGTATCTGAGGAGATTTCAGTTTACATTCAACGTGCAAGAACCAAAATGGCTGA
ATTGGGAAAGGCTCATGCGAAAGCGTTGATGCCTTCGTTTGGGGATGGTAAAGAAGATCAACATCAAATCGAGTCTTTGA
CACAAGAGATCACCTTCCTATTGAAGAAATCTGAGAAGCAACTTCAGAGGCTTTCTGCAGCTGGACCTTCTGAAGATTCA
AATGTCAGAAAAAACGTCCAGCGATCTCTTGCTACTGATCTCCAAAACCTTTCTATGGAGCTACGCAAGAAACAGTCTAC
ATATTTGAAACGTTTGAGACTACAAAAAGAGGATGGATCGGATATAGAGATGAATCTGAACGGAAGCAGCTATAATGCAG
AAGATGATGACTTTGATGATATGGTATTTAGTGAGCATCAAATAAGCAAGATAAAAAAGAGTGAGGAAATATCAGTAGAG
AGGGAGAAAGAGATTCAACAGGTTGTCGAATCCGTAAGCGAGCTTGCTCAGATCATGAAGGATCTTTCCGCGCTTGTGAT
AGACCAGGGTACGATAGTTGATCGGATTGACTATAATATCCAGAACGTTGCTAGTACCGTCGACGATGGTCTCAAACAGC
TGCAAAAGGCGGAACGTACACAGAGACAAGGAGGTATGGTGATGTGTGCATCTGTTCTTGTCATTCTCTGCTTCATCATG
CTGGTACTCTTAATCCTCAAGGAGATTCTCTTGTGA