Details for Lyrate rockcress Locus 16047185

Position : sca3 ( 5`- 9922636 .. 9925445 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898691 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047185

Protein [Map View]
MKVTQKPKIIFVPYPAQGHVTPMLHLASAFLSRGFAPIVMTPESIHRRISATNVDLGITFLALSDGQDRPDAPPSDFFSI
ENSMENIMPSQLERLLLEEDLGVACVVVDLLASWAIGVADRCGVPVAGFWPVMFAAYRLIQAIPELVRTGLVSQKGCPRQ
LEKPIVLPEQPLLSAEDLPWLIGTPKAHKNRFKFWQRTLERTKSLRWILANSFKDEYDDVNNHKASYKISKDFNKENNGQ
NPQILHVGPLHNQEATNNITITKTSFWEEDISCLGWLQEQNPNSVIYISFGSWVSPIGESNIQTLALALEASGRPFLWAL
NRVWQEGLPPGFVHRVTITKNQGRIVSWAPQLEILKNNSVGCYVTHCGWNSTMEAVASSRRLLCYPVAGDQFVNCKYIVD
VWKIGVRLSGFGEKEVEDGLRKVMEDQNMGERLKKLRDKAMGNEARLNSEMNFTLFKSEIK*

DNA
ATGAAAGTAACACAAAAGCCTAAGATAATATTCGTCCCTTATCCTGCGCAAGGCCATGTTACTCCGATGCTCCACCTTGC
ATCGGCTTTCCTTAGCCGTGGATTCGCCCCTATCGTTATGACTCCCGAGTCTATCCACCGTCGGATCTCGGCTACTAACG
TGGATCTTGGGATCACGTTCTTAGCCTTATCTGACGGGCAAGATCGTCCGGACGCACCTCCCTCGGACTTCTTCTCGATA
GAGAATTCGATGGAGAACATCATGCCCTCTCAGCTCGAACGGCTCCTACTAGAAGAAGACTTGGGTGTGGCTTGTGTCGT
GGTTGATTTGCTGGCTTCGTGGGCTATCGGAGTGGCTGATCGGTGTGGTGTTCCGGTCGCTGGATTCTGGCCGGTGATGT
TCGCTGCTTACCGTTTGATCCAAGCAATACCGGAGCTAGTACGGACAGGCTTAGTTTCCCAAAAAGGCTGTCCTCGTCAA
CTAGAAAAACCAATAGTCCTGCCAGAACAACCGCTCCTATCCGCAGAAGATCTACCGTGGCTGATCGGAACTCCGAAAGC
TCATAAAAATCGATTCAAGTTCTGGCAAAGAACTCTAGAACGAACAAAAAGTCTCCGTTGGATATTGGCAAACTCCTTTA
AAGATGAATATGATGATGTCAACAACCACAAAGCATCCTACAAAATATCTAAAGATTTCAACAAAGAAAACAATGGTCAA
AACCCTCAAATCCTTCACGTAGGTCCATTGCATAACCAAGAAGCAACAAATAATATAACTATAACCAAGACTAGTTTTTG
GGAAGAAGACATTTCTTGTCTTGGTTGGCTTCAAGAACAAAATCCAAACTCAGTCATTTATATATCATTTGGAAGTTGGG
TTTCTCCTATAGGAGAATCAAATATTCAAACATTGGCATTGGCGTTAGAAGCTTCAGGGAGACCTTTTCTTTGGGCACTA
AACCGGGTGTGGCAGGAGGGACTACCACCAGGGTTCGTGCATAGAGTCACAATTACCAAAAACCAAGGAAGGATCGTCTC
GTGGGCACCGCAACTTGAAATTCTTAAAAACAATTCTGTGGGATGTTACGTGACTCATTGTGGCTGGAACTCGACCATGG
AGGCGGTGGCAAGTTCTCGTAGGCTACTATGTTATCCCGTGGCCGGAGACCAGTTTGTGAATTGTAAATATATCGTGGAC
GTGTGGAAAATTGGGGTGAGATTGAGCGGGTTTGGAGAGAAGGAGGTTGAAGATGGGCTAAGGAAAGTAATGGAGGATCA
AAATATGGGTGAAAGATTGAAGAAGTTGAGAGATAAAGCAATGGGGAATGAAGCTCGTTTGAATTCGGAAATGAATTTTA
CACTTTTTAAAAGTGAAATAAAATAG