Details for Lyrate rockcress Locus 16047180

Position : sca3 ( 5`- 1446721 .. 1444208 -3` )
Annotation : [B2G] li-tolerant lipase 1
External links : CoGe
PGDD synteny : 16047180

Protein [Map View]
MDINCSPLGFLISLFFIVTFLAPQVKSRAFFVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDII
SEAIGMPSTLPYLSPHLTGENLLVGANFASAGIGILNDTGIQFVNIIRISKQMEYFEQYQQRVSALIGPEATQQLVNQAL
VLITLGGNDFVNNYYVIPFSARSRQFALPDYVVYLISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYG
ALQTAAALFNPRLVDLIASVNAEIGQDVFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRD
LYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTAMLLDSSRI*

DNA
ATGGATATCAATTGTTCTCCATTAGGGTTTCTAATTTCACTCTTCTTCATTGTTACTTTTCTTGCACCACAAGTCAAATC
TAGGGCTTTCTTTGTCTTCGGTGACTCTCTCGTCGACAATGGAAACAACGATTACCTTGTCACCACTGCCCGCGCCGACA
ATTACCCGTATGGTATCGACTACCCGACCCGTAGACCCACCGGACGTTTCTCTAACGGCCTTAACATTCCCGACATTATC
AGTGAGGCTATAGGCATGCCGTCGACTTTGCCGTACCTTAGCCCACATCTCACCGGAGAAAATCTTCTAGTCGGTGCTAA
TTTTGCCTCCGCCGGAATTGGAATCCTCAACGATACTGGAATTCAATTCGTAAACATAATTAGAATTTCTAAACAGATGG
AATACTTCGAACAGTACCAGCAACGAGTGAGTGCATTGATCGGACCAGAAGCTACACAACAGCTAGTTAACCAAGCTCTT
GTCCTAATCACACTCGGTGGTAATGATTTCGTCAACAATTATTATGTAATTCCGTTTTCAGCTCGTTCTCGCCAATTCGC
GTTACCAGACTACGTTGTGTATCTCATTTCCGAATACGGAAAGATTCTCAGAAAACTCTACGAACTGGGAGCAAGAAGAG
TTTTAGTAACTGGAACTGGTGCGATGGGATGTGCACCCGCGGAACTGGCTCAGCATAGCCGCAATGGCGAGTGCTATGGC
GCCCTCCAAACAGCAGCCGCTTTGTTCAATCCGCGATTAGTTGATTTGATCGCATCAGTCAATGCTGAAATTGGTCAAGA
CGTTTTTGTAGCAGCCAATGCCTATCAAATGAACATGGATTATCTAACTAATCCTGAACAATTTGGGTTTGTGACATCGA
AGGTGGCATGTTGTGGACAAGGACCGTACAATGGCATAGGACTATGCACACCAATCTCGAATTTGTGTCCGAATAGAGAC
TTATATGCGTTTTGGGATGCGTTTCATCCGACAGAGAAAGCCAATAGGATCATCGTTAATCAGATCCTGACTGGTTCCTC
CAAGTATATGCACCCTATGAATCTTAGCACCGCCATGCTCTTGGATTCTTCTAGAATCTAA