Details for Lyrate rockcress Locus 16047173

Position : sca3 ( 5`- 11009492 .. 11007789 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047173

Protein [Map View]
MNMDKETEQTLNYLPLGQSDPFGNGNDGTIGDFLGRYCNNPQEISPLTLQSFSLNSQISENFPISGGIRFPPYPGQFGSD
REFGVLGSQPTTQESNKSSLLDPDSVSDRVHTTKSNSRKRKSIPSGNGKESPASSSLTASNSKVSGENGGSKGGKRSKQD
EAGSSKNGVEKCDSKGDNKDDAKPPEAPKDYIHVRARRGQATDSHSLAERARREKISERMTLLQDLVPGCNRITGKAVML
DEIINYVQSLQRQVEFLSMKLATVNPRMEFNANAALSTEMIQPGESLTQSLYAMACSEQRLPSAYYSLGKNMPRFSDTQF
PSNDGFVQAETPGFWENNDLQSIVQMGFGDIQQQSNNNNCKKSSEPTLQMKLEP*

DNA
ATGAACATGGACAAGGAAACAGAGCAAACCCTAAATTACTTACCTTTGGGTCAGAGCGATCCCTTTGGCAATGGCAATGA
TGGAACTATCGGAGATTTCCTTGGAAGATACTGCAACAACCCTCAAGAGATTTCACCGTTAACTCTACAATCTTTCTCTC
TGAATTCTCAGATCTCTGAGAATTTCCCAATCTCTGGTGGAATCCGATTCCCTCCGTATCCAGGTCAATTTGGATCCGAT
CGAGAATTTGGGGTTCTTGGGTCACAACCAACAACGCAAGAGAGTAACAAAAGCTCGTTGTTGGATCCAGATTCAGTTTC
GGATCGAGTTCACACCACGAAATCTAACTCCAGGAAGAGGAAATCGATTCCTAGTGGTAATGGCAAGGAGTCTCCAGCTT
CTTCCTCTCTCACAGCTTCCAATTCAAAGGTTTCAGGAGAGAATGGTGGATCTAAAGGTGGGAAGAGAAGTAAGCAGGAT
GAGGCTGGGAGTAGTAAAAACGGAGTAGAGAAGTGCGATAGTAAAGGCGACAATAAGGACGATGCTAAGCCTCCTGAGGC
GCCTAAAGATTATATTCATGTTAGAGCTAGAAGGGGTCAAGCAACTGATAGCCATAGTCTTGCCGAAAGAGCAAGACGAG
AAAAGATCAGCGAGAGAATGACGTTGCTTCAGGATCTGGTTCCTGGTTGCAACCGGATTACAGGGAAAGCGGTCATGCTT
GACGAAATTATAAATTATGTGCAGTCCTTGCAGAGACAAGTTGAGTTCTTGTCCATGAAGCTGGCTACTGTAAATCCAAG
GATGGAGTTCAATGCTAATGCTGCTTTATCCACAGAGATGATTCAACCTGGGGAGTCGTTAACGCAGTCTCTTTACGCAA
TGGCTTGCTCAGAGCAAAGACTTCCATCAGCATACTATTCCCTTGGCAAGAACATGCCCAGATTCTCAGACACACAATTC
CCCTCAAACGATGGATTTGTTCAAGCTGAGACACCGGGATTCTGGGAAAATAATGACCTGCAAAGCATTGTTCAAATGGG
TTTTGGAGATATCCAGCAACAGAGCAACAACAACAACTGTAAGAAAAGTTCTGAGCCAACGCTTCAGATGAAGCTTGAGC
CATAG