Details for Lyrate rockcress Locus 16047150

Position : sca2 ( 5`- 16479257 .. 16476607 -3` )
Annotation : [B2G] adp-glucose pyrophosphorylase family protein
External links : CoGe
PGDD synteny : 16047150

Protein [Map View]
MGSSMEEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQIYLVGFYEEREFALYVSAISN
ELKVPVRYLREDKPHGSAGGLYHFRNLIMEDSPSHIFLLNCDVCCSFPLPEMLEAHRGYGGIGTLLVIKVSPESASQFGE
LVADPATNELLHYTEKPETFVSDRINCGVYVFTPEIFNAIGDVSTQRKDRATLKRVSSFEALQPATRIPTDFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLRCSGLYLSQFRLTAPQLLASGDGTRSAIVIGDVYIHPSAKVHPTAKIGPNVS
ISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSSIGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSCIVL
PNKTLNVSVQDEIIL*

DNA
ATGGGGAGCTCAATGGAGGAGAAAGTGGTGGCTGTGATCATGGTCGGTGGTCCAACCAAAGGTACTCGATTTCGGCCATT
GTCGCTGAATATTCCAAAGCCTCTGTTTCCTATTGCGGGACAACCAATGGTGCATCATCCTATTTCAGCTTGTAAAAGAA
TTCCAAATTTAGCACAAATATATCTTGTTGGCTTCTATGAGGAAAGGGAATTTGCACTTTATGTCTCAGCCATCTCTAAT
GAACTCAAAGTTCCTGTTAGATATCTGCGAGAAGACAAACCACATGGTTCAGCTGGTGGGCTGTATCACTTTAGAAATCT
TATTATGGAAGATAGCCCGTCTCATATCTTCCTGCTTAACTGTGATGTTTGCTGCAGTTTCCCCTTGCCCGAAATGCTCG
AGGCTCACAGGGGATATGGTGGAATTGGAACTCTTCTTGTGATCAAGGTCTCTCCTGAATCAGCCAGCCAATTTGGAGAA
TTGGTAGCAGATCCAGCTACTAATGAGCTGCTTCATTACACCGAGAAACCCGAAACTTTTGTCAGTGATCGTATTAACTG
TGGTGTTTATGTATTTACACCTGAAATTTTTAATGCCATAGGAGATGTTTCCACTCAGAGGAAAGATAGAGCAACTCTAA
AACGTGTTTCCAGCTTCGAAGCTCTTCAACCGGCAACAAGGATCCCGACAGATTTTGTAAGACTGGATCAAGACATCCTT
TCACCTCTAGCTGGGAAGAAACAGCTATATACTTATGAGACTATGGATTTCTGGGAGCAAATCAAATCTCCTGGAATGTC
TTTGAGGTGTTCAGGACTCTATCTTTCCCAATTCCGCTTGACCGCTCCCCAACTTTTGGCTAGTGGTGATGGAACAAGGA
GTGCCATTGTGATTGGTGATGTTTACATACATCCTTCTGCAAAAGTACATCCAACTGCAAAGATTGGTCCCAACGTCTCA
ATCTCTGCAAATGCTCGTGTTGGACCGGGCGTCAGGCTTATCAGCTGTATCATCCTTGACGACGTTGAGATCATGGAAAA
TGCAGTGGTGACTAACGCAATTGTTGGGTGGAAATCTTCTATCGGGAGATGGTCCCGTGTCCAGGCTGAGGGAGTTTACA
ATTCCAAACTCGGAGTTACAATTCTCGGAGACTCGGTTGCAGTTGAAGACGAGGTTGTGGTTACCAGCTGTATTGTTCTT
CCAAACAAGACACTGAACGTCAGTGTTCAAGATGAGATCATTTTGTAA