Details for Lyrate rockcress Locus 16047118

Position : sca3 ( 5`- 7644558 .. 7645112 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047118

Protein [Map View]
MRRLPPWMLGGASTGVAAARNASEPEAPKTKSEKRPRRVQKPKEKDLSLKSEEPKRVRRKIGEKAKRSSNGPEMIQSVTG
PEDDDLTVDDLLSFANEYVQRDEEETRKERERSLSMSETTLDLDESNTTTSSQGGTKDPTADEMLELLMGPFFKKR*

DNA
ATGAGGCGGTTACCACCGTGGATGCTCGGTGGCGCGTCCACCGGTGTAGCAGCTGCACGCAACGCTTCAGAGCCCGAAGC
TCCTAAAACAAAGTCTGAAAAACGACCAAGAAGAGTCCAAAAACCCAAAGAGAAAGACTTAAGTCTCAAATCAGAGGAAC
CTAAACGAGTTCGTAGGAAGATCGGAGAAAAAGCTAAGCGTAGTAGCAATGGCCCGGAGATGATTCAATCAGTGACTGGT
CCAGAAGATGATGATCTCACAGTTGATGACTTATTAAGCTTTGCTAATGAGTATGTCCAACGTGATGAGGAAGAAACAAG
AAAGGAGCGTGAAAGAAGCTTGTCAATGTCTGAAACTACGCTAGATCTTGATGAATCCAATACGACAACATCATCTCAAG
GAGGAACCAAAGATCCAACAGCCGATGAAATGTTAGAATTGCTAATGGGTCCTTTTTTCAAGAAACGTTAG