Details for Lyrate rockcress Locus 16047102

Position : sca3 ( 5`- 4978391 .. 4974864 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047102

Protein [Map View]
MAFVSRIRRQTDYNTYPSSIPIVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKATGETVTIVGDQDPAMMKYFDCTRS
GPRSPFDSNVVYQFEIMEYILDFAFDRLGANGSGIDHPILITECACNPVQSRSKMAELLFETYGVPAVVFGVDAAFSYKY
NQLHGICKKDGIVLCPGFTTTHAIPFVDGEPIYKGSCRTNIGGYHVTDYLKQLLSLKYPFHSSRFTWEKAEDLKLEHCYI
APDYASEIRLFQEGTKEAEEKTRYWQLPWIPPPTEVPPSEEEIARKAAIREKQGQRLREMAEAKRLSKINEMDNQLTSLH
FLLKQVDQVEEDDIPTFLSDTGYASRQELESTITKVTQSLRKARGEPKNEPAESEENTDSLNNEKYPLMNVPDDILTPEQ
LKDKRRQMFLKTTAEGRLRARQKRNEEELEKEKRNELEEERRRENPESYLVEMQAQYKEVLERVEQKKRLKTNGSSNGNN
KSGGVGRGERLSAAQRERMRLLTTAAFDRGKGEDTFGTRDEDWQLYKLMSKDNDDDDEQPDSDEAELARLSSRLQEIDPK
FVQKVEGESSQTSGEMPRVRPLTEEDYKIVIGIERFRCPEILFHPNLIGIDQVGLDEMAGTSIRRLPHDEKELEERLTSS
ILMTGGCSLLPGMKERLECGIRMIRPCGSPIDVVRAMDPVLDAWRGASAFAANLNFLGNAFTKTDYYEKGEDWLRKYQIR
YNYL*

DNA
ATGGCGTTCGTTTCGAGGATACGTAGGCAGACTGATTACAATACCTATCCATCTTCGATTCCCATTGTTATCGATAATGG
CGCTTCCTACTTCCGTATCGGGTGGGCAGGAGAAACTGAGCCTCGTGTTGTTTTCCGCAATATCGTGCAAAGACCACGCC
ACAAAGCTACAGGTGAAACAGTTACTATTGTTGGCGACCAGGATCCTGCCATGATGAAGTACTTTGATTGCACTCGCTCT
GGACCACGTTCCCCTTTTGACAGCAATGTGGTTTATCAGTTTGAGATCATGGAATATATTCTTGACTTCGCCTTTGATCG
TTTGGGTGCTAACGGATCAGGGATTGATCATCCAATCCTAATCACTGAATGTGCATGCAATCCAGTTCAATCTCGAAGCA
AAATGGCAGAACTGCTATTTGAGACTTATGGAGTGCCTGCAGTTGTATTTGGAGTCGATGCTGCTTTCAGCTACAAGTAC
AATCAACTACATGGAATTTGTAAAAAAGATGGAATTGTCCTCTGTCCTGGATTCACTACAACACACGCCATTCCGTTTGT
CGACGGAGAACCTATTTATAAAGGATCCTGCCGAACTAACATTGGTGGATATCATGTCACTGATTATTTAAAGCAGCTTC
TGTCACTTAAGTACCCTTTTCATTCGTCTAGGTTTACATGGGAGAAGGCCGAAGATTTGAAATTGGAACACTGTTATATC
GCACCTGACTATGCTTCTGAAATTCGGTTATTCCAGGAAGGAACAAAAGAAGCTGAAGAGAAAACAAGGTATTGGCAGCT
TCCATGGATACCTCCTCCCACCGAAGTTCCTCCATCAGAAGAAGAGATTGCAAGGAAGGCAGCTATAAGAGAAAAACAAG
GTCAAAGGCTGCGAGAAATGGCTGAAGCAAAGAGATTGTCCAAGATAAATGAAATGGATAATCAATTGACTAGCTTGCAT
TTCCTTTTGAAGCAAGTTGACCAGGTTGAAGAGGATGATATTCCAACATTTTTGTCAGACACCGGTTACGCGTCCAGGCA
AGAGCTAGAATCTACTATTACGAAAGTGACACAATCGCTTAGAAAAGCAAGGGGCGAGCCGAAGAATGAACCAGCTGAGA
GTGAAGAGAACACTGATTCTCTTAATAATGAAAAATATCCTCTTATGAATGTCCCCGATGATATACTTACTCCTGAGCAG
CTTAAGGACAAGAGGAGGCAAATGTTTCTTAAAACAACAGCAGAGGGTCGGCTACGAGCTAGACAAAAGCGTAATGAGGA
GGAACTCGAAAAAGAAAAAAGAAATGAATTAGAGGAGGAAAGACGTCGTGAGAACCCAGAGTCTTACTTAGTGGAGATGC
AAGCTCAGTACAAGGAAGTGTTGGAGAGAGTTGAGCAGAAGAAACGTCTGAAAACAAACGGGTCCAGTAATGGGAATAAC
AAGTCTGGAGGTGTTGGGCGAGGCGAGCGACTAAGTGCTGCACAGAGGGAGAGAATGCGTCTGCTGACTACAGCAGCGTT
TGATAGAGGGAAAGGCGAGGATACGTTTGGTACTAGAGATGAAGATTGGCAGCTCTACAAACTTATGAGCAAGGATAATG
ACGACGATGACGAACAACCTGATTCAGACGAGGCTGAGTTGGCTCGTTTATCATCTAGACTTCAGGAAATAGACCCAAAA
TTTGTGCAGAAAGTAGAAGGAGAATCGAGTCAGACATCAGGGGAGATGCCTCGTGTTCGTCCATTAACAGAGGAAGACTA
CAAGATAGTGATTGGTATCGAAAGATTCCGTTGCCCTGAGATCCTGTTCCATCCAAACCTGATTGGGATTGACCAAGTAG
GCTTAGACGAGATGGCCGGTACATCAATAAGAAGGCTACCGCACGATGAGAAAGAGTTAGAGGAGAGGCTAACGAGCTCG
ATACTGATGACGGGCGGGTGTAGCCTTCTTCCAGGGATGAAAGAGCGGTTGGAATGTGGGATTAGGATGATAAGACCGTG
CGGATCACCCATAGACGTGGTTCGAGCTATGGATCCAGTGCTGGATGCATGGCGTGGAGCATCTGCGTTTGCTGCTAATT
TGAACTTCTTGGGGAACGCCTTTACTAAGACGGATTACTACGAGAAAGGTGAAGATTGGCTTAGAAAATATCAAATTCGA
TACAATTATTTGTGA