Details for Lyrate rockcress Locus 16047091

Position : sca3 ( 5`- 4521129 .. 4520207 -3` )
Annotation : [B2G] myb family transcription factor
External links : CoGe
PGDD synteny : 16047091

Protein [Map View]
METLHPFSHLPISDHRFVVQEMVSLHSSSSSSSWTKEENKMFERALAIYAEDSPDRWFKVASMIPGKTVLDVMKQYSKLE
EDVFDIEAGRVPIPGYPAASSPLAFDPDTCRKRPNGARGSDQDRKKGVPWTEEEHRRFLLGLLKYGKGDWRNISRNFVVS
KTPTQVASHAQKYYQRQLSGAKDKRRPSIHDITTGNLLNANLNRSFSDHTGILPDLGFIDKDNAEDGVIFMGQNVSSENL
FSPSPTSFEAAINFAGQNAFSAGA*

DNA
ATGGAGACTCTGCATCCATTCTCTCACCTACCTATCTCTGACCACCGGTTCGTTGTCCAAGAGATGGTGAGCTTACACAG
CTCCAGCAGCAGTAGTAGCTGGACTAAAGAAGAGAACAAGATGTTCGAACGAGCTCTTGCGATATACGCTGAAGACTCGC
CTGATCGCTGGTTTAAAGTTGCTTCCATGATCCCTGGAAAGACTGTTTTGGATGTTATGAAGCAATATAGCAAGCTTGAA
GAAGATGTTTTCGATATCGAAGCAGGACGTGTTCCCATTCCTGGTTACCCTGCAGCTTCTTCTCCCTTGGCGTTTGATCC
TGACACGTGTCGGAAACGGCCTAATGGAGCCAGAGGATCTGATCAAGATCGAAAGAAAGGAGTCCCTTGGACGGAGGAAG
AACACAGGAGATTCTTGTTGGGGCTTCTCAAGTACGGTAAAGGAGATTGGAGAAACATATCAAGAAACTTTGTTGTGTCA
AAGACACCAACGCAAGTGGCGAGCCACGCCCAAAAGTATTATCAGAGACAACTCTCCGGAGCCAAGGACAAGCGCCGGCC
AAGTATCCATGACATCACTACCGGCAATCTTCTTAATGCCAATCTCAACCGTTCCTTTTCCGATCACACAGGTATCCTCC
CTGATTTAGGGTTTATCGACAAGGATAATGCTGAGGACGGAGTAATATTTATGGGTCAGAATGTATCTTCAGAAAACCTG
TTTTCTCCATCACCAACTTCATTCGAAGCTGCCATTAACTTCGCCGGACAAAATGCTTTCAGTGCCGGAGCTTAA