Details for Lyrate rockcress Locus 16047069

Position : sca3 ( 5`- 1103719 .. 1102652 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16047069

Protein [Map View]
MGSTGNPNPWGTYDSYRDCSQGVCSVYCPQWCYVIFPPPPSFYLDDEDDSSSSDFSPLLIALIGILASAFILVSYYTLIS
KYCHRRRHNSSSSTSAAVINRDHGISSDYTWQEATNPNPTIGGGDGLDESLIKSITVYKYRKMDGFVESSDCSVCLSEFQ
ENESLRLLPKCNHAFHVPCIDTWLKSHSNCPLCRAFIAGVNVTSSAVEIVAVTNQPIATENNSISIGDDSVVINLDLENS
RSRNETVNGGSTPKPPEMQELRDGEEEVTRRSATLNSGAAVVSIADILREIEDEEESAGVGTSRWVEEGEGEKTPPPSGS
AANQTNGISNFLVRSSMAAMKRSGYDRAKNYRLPK*

DNA
ATGGGTTCAACAGGAAACCCTAATCCATGGGGTACATACGATTCATACAGAGACTGTTCTCAAGGAGTATGCAGTGTCTA
TTGCCCTCAATGGTGTTACGTCATCTTCCCTCCTCCTCCTTCCTTCTACCTCGACGACGAAGACGACTCTTCCTCCTCTG
ATTTCTCTCCTCTCCTCATCGCTCTTATCGGAATCCTCGCTAGTGCCTTCATCCTCGTCAGCTACTACACTCTCATCTCC
AAATACTGCCACCGCCGTCGCCACAACTCCTCCTCCTCCACCTCCGCCGCAGTTATAAACCGAGATCATGGAATCTCATC
AGATTACACATGGCAAGAAGCTACGAATCCGAATCCGACGATTGGTGGTGGTGATGGACTCGATGAATCTCTGATTAAAT
CGATTACTGTTTACAAATACAGAAAGATGGATGGATTTGTTGAATCATCAGATTGTTCTGTTTGTTTAAGCGAGTTTCAA
GAAAACGAGAGCTTGAGATTGTTACCTAAATGCAACCACGCGTTTCATGTTCCTTGTATTGATACTTGGTTGAAATCTCA
CTCTAATTGTCCTCTCTGCCGTGCTTTCATCGCCGGAGTTAACGTCACTTCCTCCGCCGTTGAGATCGTCGCTGTAACTA
ATCAACCGATCGCTACAGAGAACAACTCGATTTCGATCGGAGATGATTCCGTCGTTATTAACTTAGATCTGGAAAATTCC
AGATCTCGAAATGAGACGGTTAACGGCGGATCGACGCCGAAACCGCCGGAGATGCAGGAGTTAAGAGACGGAGAAGAGGA
GGTGACTCGGAGATCGGCGACGTTAAACTCAGGCGCCGCTGTGGTATCGATCGCTGATATACTAAGGGAGATTGAAGACG
AAGAAGAATCAGCAGGTGTAGGAACTTCTAGGTGGGTAGAAGAAGGGGAAGGAGAGAAGACACCTCCGCCGTCAGGATCG
GCGGCTAATCAAACAAACGGAATTTCGAATTTTCTGGTTCGGAGTTCAATGGCGGCGATGAAGAGATCTGGTTACGATAG
GGCAAAAAATTACCGTTTACCGAAATAA