Details for Lyrate rockcress Locus 16047061

Position : sca3 ( 5`- 3520127 .. 3520957 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047061

Protein [Map View]
MTLLLHQLNHIHKPPVVLYRRLRKPYRLPVISAVSGKELILSGKVRSVEPKEAKTVVASEGYVLLDVRPAWEREKARVKG
SLHVPLFVEDTDNGPITLLKKWIHLGYIGLWTGQRFTMFNDEFTLRVVEAVPDKESKVLVVCGEGLRSLAAVSKLHGEGY
KSLGWLAGGFNRVTEGDFPEIEGTEELRFATIGGVSFYLLKLIVLLPSFGQKSR*

DNA
ATGACACTTCTTCTTCATCAACTAAACCATATCCACAAGCCACCAGTAGTACTATACCGACGCCTCCGAAAACCATACAG
ATTACCAGTGATCTCCGCCGTGTCCGGTAAAGAACTGATACTTTCCGGCAAGGTCCGGTCGGTGGAGCCGAAAGAAGCCA
AGACGGTTGTGGCGTCGGAGGGATACGTGCTCTTAGACGTGAGGCCGGCTTGGGAAAGAGAAAAGGCACGTGTGAAAGGG
TCCTTACACGTGCCCCTGTTCGTGGAGGATACAGACAATGGGCCGATTACGTTGCTGAAGAAATGGATTCATTTGGGATA
CATTGGGCTTTGGACGGGCCAGAGATTCACCATGTTCAATGACGAATTCACCCTCCGTGTTGTGGAGGCTGTCCCGGACA
AAGAGAGTAAAGTGCTCGTCGTGTGCGGTGAAGGACTCAGGTCGTTGGCGGCTGTATCAAAACTCCACGGAGAAGGGTAC
AAAAGCTTAGGGTGGTTAGCCGGAGGGTTTAACCGAGTAACCGAGGGAGATTTTCCAGAGATAGAAGGGACCGAAGAGCT
TCGGTTCGCCACGATAGGAGGTGTATCATTTTATTTACTCAAACTAATTGTACTGTTACCGTCTTTTGGCCAGAAGAGTC
GTTAA