Details for Lyrate rockcress Locus 16046997

Position : sca3 ( 5`- 9585321 .. 9582239 -3` )
Annotation : [B2G] kinase family protein
External links : CoGe
PGDD synteny : 16046997

Protein [Map View]
MKLNSLIAPLLLLLFSSSFLFFAVESKCRNSCDLALASYYLANGTTLSAINQNLNSSIAPYDQVNFDPILRYNPNIRDKD
RIQMGSRVLVPFPCECQPGDFLGHNFSYSVRQEDTYERVAIRNYANLTTVESLQARNPFPATNIPLSATLNVLVNCSCGD
ESVSKDFGLFVTYPLRPEDSLSSIARSSGVSADILQRYNPGVNFNSGNGIVYVPGRDPSGAFPAFKSSKQGGIGAGVIAG
IVVGVIVALLLILFIIYYAYRKSKSKGDSYSSSIPLSTKADLASSTSLQSGGLGGTGVSPGIAAISVDKSVEFTLEELAK
ATDNFNLSFKIGQGGFGAVYYAELRGEKAAIKKMDMEASKQFLAELKVLTRVHHVNLVRLIGYCVEGSLFLVYEYVENGN
LGQHLHGSGQEPLPWTKRVQIALDSARGLEYIHEHTVPVYVHRDIKSANILIDQNFRAKVADFGLTKLTEVGGSATRGAM
GTFGYMAPETVYGEVSAKVDVYAFGVVLYELISAKGAVVKMTEAVGEFRGLVGVFEEAFKETDKEEALRKIIDPRLGDSY
PFDSVYKMAELGKACTQENAQLRPSMRYIVVALSTLFSSTGNWDVANFQNDDLVSLMSGR*

DNA
ATGAAGCTAAATTCTCTAATCGCTCCGCTTCTTCTTCTTCTCTTCTCATCGTCGTTTCTCTTCTTCGCCGTCGAATCTAA
GTGCAGGAACAGCTGCGATTTAGCTCTAGCTTCTTACTACCTCGCTAATGGAACAACTCTCTCCGCCATCAACCAAAACC
TCAATTCTTCAATCGCACCTTACGATCAAGTCAATTTCGATCCAATCCTTAGGTACAACCCGAACATTAGAGACAAAGAT
AGAATCCAGATGGGTTCTAGGGTTCTTGTACCTTTCCCTTGCGAATGTCAGCCTGGTGATTTTCTAGGGCACAATTTCAG
CTACAGTGTTCGACAAGAAGATACTTATGAAAGAGTGGCGATCAGGAATTACGCGAATTTAACGACGGTGGAATCCTTGC
AGGCGAGGAATCCTTTTCCGGCGACTAATATCCCGCTCTCCGCGACGCTTAATGTGTTGGTGAATTGTTCTTGTGGTGAT
GAGAGTGTTTCTAAGGATTTTGGTTTGTTTGTTACTTATCCGCTTCGTCCTGAAGATAGTCTCAGTTCGATTGCGAGATC
TTCCGGTGTATCGGCGGATATTCTGCAGAGATATAATCCTGGTGTTAATTTTAACTCAGGGAATGGAATCGTTTATGTGC
CGGGAAGAGATCCAAGTGGTGCATTTCCAGCTTTCAAATCAAGTAAACAAGGTGGTATTGGTGCTGGAGTTATTGCTGGT
ATAGTTGTAGGAGTGATTGTGGCTTTGTTGTTAATCTTGTTTATCATATATTATGCTTACCGGAAGAGCAAGTCGAAGGG
TGATTCGTATTCATCTTCTATTCCGTTGTCTACTAAGGCTGATCTTGCTTCTTCTACCAGCCTCCAAAGTGGAGGCTTGG
GTGGTACCGGAGTATCTCCTGGCATTGCTGCCATAAGCGTGGACAAATCTGTTGAGTTTACGTTGGAGGAGCTCGCAAAG
GCTACTGATAATTTCAATCTGTCTTTTAAGATTGGTCAAGGTGGTTTTGGGGCTGTTTACTATGCAGAGCTGAGAGGAGA
AAAAGCTGCGATCAAGAAGATGGACATGGAGGCATCGAAACAGTTCTTGGCGGAACTAAAAGTCTTAACGCGTGTACATC
ATGTCAACCTGGTTCGCCTGATTGGATATTGTGTTGAGGGATCACTTTTCTTGGTGTATGAATATGTTGAGAATGGCAAC
CTTGGACAACATTTACATGGGTCAGGACAAGAACCACTACCGTGGACTAAGAGAGTGCAGATTGCACTAGACTCAGCTAG
AGGTTTAGAATATATCCACGAGCACACGGTTCCTGTCTATGTCCACAGGGACATTAAATCTGCCAATATTTTGATAGACC
AGAATTTTCGAGCAAAGGTAGCAGATTTCGGGTTAACAAAACTGACAGAAGTTGGAGGCTCAGCAACTCGTGGTGCAATG
GGTACATTTGGTTACATGGCACCAGAGACTGTTTATGGAGAAGTATCTGCAAAAGTAGATGTATATGCATTTGGAGTTGT
CCTTTACGAATTGATTTCTGCGAAAGGCGCGGTTGTCAAAATGACGGAAGCCGTTGGTGAATTTAGAGGCCTCGTTGGTG
TGTTCGAAGAAGCATTCAAGGAGACCGACAAAGAAGAAGCACTACGTAAGATTATAGACCCGAGGCTTGGGGATAGCTAC
CCGTTTGATTCGGTATATAAGATGGCGGAATTAGGGAAAGCTTGTACACAAGAGAATGCTCAACTACGTCCGAGTATGAG
ATACATTGTGGTTGCTTTATCCACTCTTTTCTCGTCAACTGGAAATTGGGATGTTGCAAACTTCCAAAACGATGATTTAG
TCAGTCTTATGTCTGGCCGGTAG