Details for Lyrate rockcress Locus 16046992

Position : sca3 ( 5`- 7533800 .. 7534489 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046992

Protein [Map View]
MAANACLPPPALMAVRAEEGVPNSKSTQGKTRLYLTKPSWIVRTQSGAKTCMKRKAKGRCVICHGTGRVDCFNCCGKGRT
NCVDVEMLPKGEWPKWCKSCGGSGLSDCSRCLGTGEYRYIMGFRFLNQNDDGDPQL*

DNA
ATGGCGGCGAACGCGTGTCTACCTCCGCCGGCGTTAATGGCTGTCCGCGCAGAGGAAGGAGTTCCAAATTCAAAATCGAC
GCAGGGAAAAACTAGGCTCTATCTCACCAAACCTTCATGGATAGTTAGAACTCAGTCAGGAGCTAAGACGTGTATGAAGA
GGAAGGCGAAAGGCCGGTGCGTAATCTGCCATGGAACTGGAAGAGTCGACTGTTTCAATTGCTGTGGGAAAGGGAGGACT
AATTGTGTGGATGTGGAAATGCTTCCAAAAGGAGAATGGCCTAAATGGTGCAAGAGTTGTGGAGGGAGTGGATTAAGTGA
CTGTTCTCGCTGTCTTGGCACCGGAGAGTACAGATACATTATGGGTTTCCGCTTCTTAAACCAAAACGACGATGGCGATC
CACAATTATGA