Details for Lyrate rockcress Locus 16046986

Position : sca3 ( 5`- 4241190 .. 4243134 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046986

Protein [Map View]
MDATDIWGEIERSESYLVCSMYEEAESLSSSTLKIIFGNIDVLSEGEHQFHDILESAGMVLVQSLHGISRTVEIVNELRD
VFGEVAAIPVQVLLTGICLQISNGSYSGVCEILEEFFSIWVYKDSHYILNDAGVSAKGFHEKNCLDIDEYMEVVELYTFG
VLAKVSNDIGLAISWVEKAALPEERRQGILRRLHSLLSFKTANVPDASSFEENSKDSSYAVVNNKKSLANEKKDKIDSVL
KLSKQHEPWSLWSSHPLSLKVGNTQFSMSRGKFAISLVGLIICYALKRKRAALIRIIRRQMESTRKAIVDFWKLAFSYQV
NPLAAIQSIPSTTT*

DNA
ATGGATGCAACTGATATTTGGGGAGAAATTGAACGTTCTGAGAGTTACCTAGTGTGCTCTATGTATGAAGAGGCAGAGTC
ATTATCCTCTTCTACACTGAAAATAATATTTGGCAACATTGATGTTCTATCCGAGGGAGAACATCAGTTTCATGATATTT
TAGAATCTGCTGGCATGGTTTTAGTCCAATCCTTGCATGGAATCAGCAGGACAGTTGAGATTGTGAATGAGTTAAGAGAT
GTGTTTGGAGAAGTTGCAGCTATTCCTGTTCAAGTTCTTCTCACTGGAATATGCCTTCAAATATCAAATGGTTCCTACTC
GGGTGTATGTGAGATTCTGGAAGAGTTCTTTAGCATATGGGTTTACAAGGACAGCCACTATATCCTAAATGATGCTGGAG
TAAGTGCAAAAGGATTCCATGAGAAAAACTGTTTAGATATTGATGAGTACATGGAAGTAGTGGAGCTGTATACCTTTGGA
GTTCTTGCAAAAGTTTCAAACGACATAGGCCTAGCCATTTCATGGGTTGAGAAAGCTGCGTTACCTGAGGAAAGACGACA
GGGGATTTTGAGAAGATTGCATTCGTTACTTTCATTCAAAACAGCAAACGTTCCAGACGCTAGTTCTTTTGAGGAAAATT
CTAAAGATTCTTCTTATGCTGTAGTGAATAACAAGAAGTCGTTGGCTAATGAAAAGAAGGATAAGATTGATTCTGTCCTG
AAACTCTCTAAACAACATGAACCTTGGTCACTTTGGTCATCCCATCCTCTAAGCCTCAAGGTTGGTAATACCCAATTTAG
CATGTCCAGGGGAAAGTTTGCCATAAGCCTTGTTGGATTAATCATATGTTATGCCTTGAAGAGAAAACGAGCTGCTTTGA
TACGGATCATTCGCAGGCAAATGGAGTCCACGAGAAAAGCAATAGTAGATTTCTGGAAGCTTGCGTTTTCATACCAAGTG
AATCCTCTTGCAGCAATTCAATCCATACCAAGCACCACAACATGA