Details for Lyrate rockcress Locus 16046908

Position : sca3 ( 5`- 3899730 .. 3900547 -3` )
Annotation : [B2G] uncharacterized protein
External links : CoGe
PGDD synteny : 16046908

Protein [Map View]
MEKYFGNAYRGDPGVPHADADRFVNIWIGSAAFSVLTWVNPYMWQLSNQFNYHDKWMLFEQYHWKKARAKKQPYEFKWNK
IPKEVRDSYYYNWPVYFP*

DNA
ATGGAGAAGTACTTTGGAAATGCATACAGGGGAGATCCAGGAGTGCCACATGCTGATGCAGATCGGTTTGTGAATATATG
GATTGGTTCTGCTGCTTTCTCTGTTCTCACCTGGGTCAATCCTTACATGTGGCAGCTCTCTAACCAGTTCAATTATCATG
ATAAGTGGATGCTGTTTGAGCAGTACCACTGGAAAAAAGCAAGGGCAAAGAAGCAGCCTTATGAATTCAAGTGGAATAAG
ATACCCAAAGAAGTCAGGGACTCGTACTATTACAACTGGCCTGTCTACTTCCCATAA