Details for Lyrate rockcress Locus 16046877

Position : sca3 ( 5`- 9462192 .. 9463674 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479655 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16046877

Protein [Map View]
MDSSLLSAATADTFNGNATDQIPPPSQPPGTDMTGISFRDQLWINSYPLDRNYIFDYFALSPFYDTTCNNEILRRRSIHP
LDLSHLSKMTGLEYMLTDATEPNLFVFRKQKRDGPEKVTPMLTYYILDGSIYQAPQLCSVFAARVSRTIYNISKAFSVAA
SKLETIRQVDTENQNEPSESKPASETVDLKEMKRVDVILTSLYRKLAPAPPPPPFPEGYVSQEALGEKEELGTQGGESQP
PQIDPIIDQGPAKRMKL*

DNA
ATGGACTCCTCTCTACTCTCGGCGGCTACGGCCGATACCTTCAACGGCAATGCGACGGATCAGATTCCTCCTCCGTCGCA
ACCTCCGGGCACGGATATGACTGGAATATCCTTCAGGGATCAGCTCTGGATCAATTCATATCCTCTTGATCGTAACTACA
TCTTCGATTACTTCGCTTTGTCTCCCTTCTACGATACAACCTGCAACAATGAGATTCTTCGGAGAAGATCCATTCACCCT
CTCGATCTCTCTCACCTCTCGAAGATGACAGGACTTGAGTATATGCTAACTGATGCTACTGAACCTAACCTGTTCGTCTT
CCGTAAGCAGAAGAGAGATGGTCCTGAGAAAGTCACACCCATGCTAACTTATTATATCTTGGATGGTTCTATATACCAAG
CTCCTCAGCTTTGTAGTGTCTTCGCAGCTCGTGTTAGTCGGACTATTTATAATATATCCAAGGCTTTCTCTGTTGCTGCA
TCGAAATTGGAGACCATTAGACAAGTTGATACTGAAAACCAGAACGAACCCTCTGAGTCGAAGCCTGCTAGTGAGACAGT
TGATCTAAAAGAAATGAAGCGAGTTGATGTCATTCTTACCTCGTTATACCGCAAGTTAGCACCAGCACCCCCACCGCCAC
CGTTTCCTGAAGGTTATGTTAGCCAAGAAGCATTAGGAGAAAAGGAAGAGCTTGGAACACAGGGAGGAGAGTCACAACCG
CCTCAAATTGATCCTATTATCGATCAAGGTCCGGCTAAAAGAATGAAATTATAA