Details for Lyrate rockcress Locus 16046819

Position : sca3 ( 5`- 7266948 .. 7263669 -3` )
Annotation : [B2G] HCF107 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16046819

Protein [Map View]
MHFFIVPNSSSSSPSPANTSSFSLLFLAPSQIPENLCKLPAKIHIGTHGISGKSFLTHPTFSSKNTTLYAVVDRSSSGVF
SSQNESANGEGGESNTEGVLVVRRPSLENSDKESSEEEGKKYPARIDAGLSNIAKKMPMFEPERSESSSSTSAAAAASAQ
ERPLAVNLDLSLYKAKVLARNFRYKDAEKILEKCIAYWPEDGRPYVALGKILIKQSKLAEARIVYEKGCQSTQGENAYIW
QCWAVLENRLGNVRRARELFDAATVADKKHVAAWHGWANLEIKQGNISKARNLLAKGLKFCGRNEYIYQTLALLEAKAAR
YEQARYLFKQATICNSKSCASWLAWAQLEIQQERYPAARKLFEKAVQASPKNRFAWHVWGVFEAGVGNVERGRKLLKIGH
ALNPRDPVLLQSLGLLEYKHSSANLARALLRRASEVDPRHQPVWIAWGWMEWKEGNTTTARELYLRALSIDANTESAARC
LQAWGVLEQSAGNLSAARRLFRSSLNINSQSYVTWMTWAQLEEDQGDSERAEEIRNLYFQQRTEVVDDASWVTGFLDIID
PALDTVKRLLNFGQNNDNNRLTTTLRNMNGTKDSQSNQQPESSVGREDTETGSGFNLDAFLREKLSLDPTKLDVNLDSKK
LDRFTRGRINGA*

DNA
ATGCACTTCTTCATAGTGCCGAATTCTTCGTCTTCATCTCCTTCTCCGGCAAATACTTCTTCATTCTCTCTATTGTTTCT
CGCTCCTTCTCAAATTCCTGAGAATCTCTGTAAATTGCCGGCGAAGATCCATATCGGAACTCATGGAATCTCCGGTAAAT
CGTTTCTCACACATCCTACGTTCTCATCTAAGAACACGACTCTGTATGCAGTCGTCGACAGGTCTTCTTCAGGTGTATTT
TCGTCACAAAATGAATCTGCCAATGGCGAAGGAGGGGAATCTAACACGGAGGGAGTATTAGTAGTTCGACGGCCGTCGTT
GGAGAATTCCGATAAGGAATCTAGTGAGGAAGAGGGAAAAAAGTATCCAGCGAGGATTGATGCTGGTCTGAGTAATATAG
CTAAGAAGATGCCGATGTTTGAGCCGGAGAGATCGGAGTCGTCATCGTCGACGTCCGCCGCCGCTGCTGCAAGTGCTCAA
GAGAGGCCGCTTGCCGTGAATTTGGACTTATCTCTGTACAAAGCAAAGGTTTTGGCGAGGAATTTCAGATACAAAGACGC
CGAGAAGATTCTGGAGAAGTGCATAGCTTACTGGCCGGAGGATGGGAGACCGTACGTGGCATTGGGGAAGATACTAATCA
AACAATCGAAGCTAGCAGAAGCTCGAATTGTGTATGAGAAAGGGTGTCAATCTACACAAGGAGAGAATGCATACATTTGG
CAGTGTTGGGCTGTCCTGGAAAACAGGTTGGGAAATGTAAGAAGAGCCAGAGAGTTGTTTGATGCAGCCACGGTGGCTGA
CAAGAAGCATGTAGCAGCCTGGCATGGATGGGCAAACCTGGAGATAAAACAAGGAAATATTAGTAAAGCGAGGAATCTCC
TAGCCAAAGGCCTCAAGTTCTGTGGCCGTAACGAGTATATCTACCAAACACTTGCCTTGTTGGAGGCCAAAGCTGCCCGG
TATGAACAGGCAAGGTACCTGTTCAAGCAGGCCACCATATGCAATTCGAAGAGCTGTGCCAGTTGGTTGGCATGGGCACA
GTTGGAGATACAGCAGGAAAGATACCCAGCTGCTAGAAAGCTTTTTGAGAAAGCTGTCCAGGCAAGCCCCAAGAATAGGT
TTGCGTGGCACGTATGGGGGGTGTTTGAAGCTGGAGTAGGTAATGTTGAGCGTGGAAGAAAGCTCCTGAAGATAGGTCAT
GCGCTAAATCCTAGAGACCCTGTTCTCCTTCAGTCCCTTGGCTTACTGGAGTACAAGCATTCATCTGCTAATCTTGCCCG
GGCTTTACTAAGGAGAGCATCAGAGGTTGATCCTAGACATCAACCTGTTTGGATTGCTTGGGGTTGGATGGAATGGAAAG
AAGGAAACACAACAACAGCTAGAGAACTTTACCTAAGAGCTCTCTCCATTGATGCAAATACCGAAAGTGCTGCTCGTTGT
CTACAGGCGTGGGGAGTTCTCGAGCAGAGTGCAGGAAACTTATCAGCAGCTAGAAGATTATTTCGATCTTCACTGAACAT
CAACTCACAAAGCTACGTTACGTGGATGACATGGGCACAACTAGAGGAAGATCAAGGAGACTCCGAACGTGCTGAAGAAA
TCCGTAACCTCTATTTCCAACAGCGTACCGAGGTTGTTGATGATGCTTCGTGGGTCACAGGATTCTTGGATATCATTGAC
CCGGCTTTAGACACTGTTAAAAGGCTCTTGAACTTTGGTCAAAACAATGATAACAACAGGTTAACTACTACTCTTAGAAA
CATGAATGGAACCAAAGATAGCCAATCCAATCAGCAACCCGAGAGCTCAGTGGGACGCGAGGACACTGAAACTGGGAGCG
GATTTAACCTCGATGCATTTTTACGCGAGAAGCTCTCGTTGGATCCTACGAAGCTGGACGTTAACCTTGATTCTAAGAAG
TTAGATAGATTCACTAGAGGGAGAATAAATGGTGCTTGA