Details for Lyrate rockcress Locus 16046807

Position : sca3 ( 5`- 7011261 .. 7009139 -3` )
Annotation : [B2G] atp binding protein
External links : CoGe
PGDD synteny : 16046807

Protein [Map View]
MDFPPTKLDYHVDMFNLQSQSRFISVFKAQDGRIALILDSTLFHPQGGGQPADTGLIVFSGSDFKFSVQDVRSKDGIVLH
YGVFEGSNPESGMDIEKGKEVYVTVDESRRKLNSRLHSAGHLLDLCMQKVGLGHLEPGKGYHFPDGPFVEYKGSVPQGQM
AVKQKELEAEANDLITKGGKVYAAILPYEEASVLCGGNLPDYISKGSTPRIIKLGDSPGCPCGGTHVSDLSDIIAMKVTQ
MRTKKGITKVFYSIAS*

DNA
ATGGATTTTCCTCCGACGAAGCTTGATTATCATGTAGACATGTTCAATCTTCAATCTCAATCCAGATTTATCTCCGTATT
TAAGGCGCAAGATGGACGCATAGCTCTAATACTGGACTCGACGTTGTTTCATCCACAAGGTGGTGGCCAGCCGGCAGACA
CCGGTTTAATTGTTTTCTCCGGTTCGGATTTCAAGTTTTCCGTTCAAGATGTTCGATCGAAAGACGGAATTGTTCTCCAT
TACGGAGTTTTCGAAGGTTCGAATCCTGAGAGTGGAATGGATATTGAGAAAGGGAAAGAAGTTTACGTAACTGTTGATGA
ATCAAGGCGTAAACTCAATTCCAGGTTGCACTCAGCTGGACATTTGCTAGATTTGTGTATGCAGAAAGTTGGGTTAGGGC
ATTTGGAGCCTGGAAAAGGGTACCATTTTCCGGACGGTCCATTTGTAGAATACAAAGGAAGCGTTCCACAGGGTCAGATG
GCAGTGAAGCAGAAAGAGTTGGAGGCAGAAGCTAATGACCTGATAACCAAAGGAGGAAAGGTTTATGCTGCTATATTACC
CTATGAAGAGGCATCTGTGCTCTGTGGTGGCAATCTTCCTGATTATATTTCCAAGGGCAGCACTCCCCGGATCATAAAAT
TAGGTGACAGCCCCGGGTGTCCGTGTGGTGGAACCCATGTCTCCGATTTATCTGATATCATAGCCATGAAGGTCACACAG
ATGAGAACAAAGAAAGGAATAACGAAAGTTTTCTACAGCATTGCATCTTGA