Details for Lyrate rockcress Locus 16046801

Position : sca3 ( 5`- 4033012 .. 4035167 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046801

Protein [Map View]
MMMSFSSSIASSSSLSLLLSSSHKKLPIDLNSFPNPNQRCSVSVRTARVVAAMNRAIRRQRQSQAVSATESRVSLVFALA
SQASSVSQRLLADLAVETAKYVFPKRFNSSNLEEALMSVPDLETMEFRVVSRTDKYEIRQVEPYFVAETTMPGETGFDFY
GASKSFNVLAEYLFGKNTRKEKMEMTTPVVTRKAQSVGEKMEMTTPVITTKAKDQTQWRMSFVMPSKYGSNLPLPKDSSV
KILEVPRKIVAVVAFSGYVTDEEIERREQELRRALQNDKKFRVRDGVSVEVAQYNPPFTLPFMRRNEVSLEVESKED*

DNA
ATGATGATGAGCTTCTCCTCCTCCATTGCATCATCATCATCCCTCTCTCTTCTTCTGTCTTCATCTCACAAGAAATTGCC
CATCGATCTCAATTCGTTTCCAAACCCTAACCAGAGATGCTCAGTTAGCGTCAGAACGGCGAGAGTGGTTGCTGCTATGA
ACAGAGCTATCCGGCGTCAGCGGCAGAGTCAAGCCGTGTCCGCCACTGAATCCAGGGTTTCTCTTGTCTTTGCTCTCGCC
TCTCAGGCTTCCTCTGTCTCTCAACGCCTTTTAGCTGATTTGGCGGTGGAGACTGCGAAATACGTTTTCCCGAAGAGATT
CAATAGCTCTAATCTTGAAGAAGCGTTGATGTCCGTTCCTGATCTCGAGACAATGGAATTCAGAGTTGTAAGTAGGACTG
ATAAGTACGAGATTAGACAAGTTGAGCCTTACTTTGTCGCCGAGACTACAATGCCAGGGGAAACTGGATTTGACTTCTAT
GGTGCTTCTAAGTCTTTTAATGTGTTAGCTGAGTACCTATTTGGTAAGAACACAAGAAAGGAGAAAATGGAGATGACGAC
CCCTGTTGTTACTCGTAAAGCCCAATCTGTTGGAGAAAAGATGGAAATGACTACTCCAGTAATTACTACCAAGGCAAAAG
ATCAAACTCAGTGGCGGATGTCTTTTGTCATGCCCTCAAAGTATGGTTCGAATTTGCCACTGCCAAAAGATTCTTCAGTC
AAAATTCTGGAGGTGCCACGAAAGATTGTTGCTGTTGTAGCTTTCTCAGGCTATGTTACCGATGAAGAGATTGAGAGACG
GGAGCAAGAATTAAGGCGGGCTCTTCAAAACGACAAGAAGTTTCGAGTGAGAGATGGAGTTTCAGTTGAAGTTGCACAGT
ATAATCCACCATTCACTCTCCCGTTTATGCGCCGCAACGAGGTCTCTCTGGAAGTTGAAAGCAAAGAAGATTAG