Details for Lyrate rockcress Locus 16046784

Position : sca3 ( 5`- 7302616 .. 7302068 -3` )
Annotation : [B2G] invertase pectin methylesterase inhibitor family protein
External links : CoGe
PGDD synteny : 16046784

Protein [Map View]
MKRSSTVTSLPSLSLFLLLLLPSVVQSSDDLIDKICQATPFCDLCEASLRPLSPSPSDPKSLAVAMASVVLGNMTDTLGY
IQSLIKHSHDPAVERALAQCAELYRPVVKFNIPQAMEAMQGGKFGFAIYVLGDAEKQTDSCQKGITNTGADDESSVAVTA
RNKLVKNLCDVAISVLKSLMSL*

DNA
ATGAAGAGATCCTCCACAGTCACATCATTACCGTCTCTCTCCCTCTTTCTCCTCTTGCTACTGCCGTCGGTAGTCCAATC
CTCCGACGACCTTATCGACAAAATATGCCAAGCAACGCCGTTCTGCGACCTCTGTGAAGCCTCTCTCCGTCCACTCTCTC
CTTCACCTTCTGATCCAAAATCCTTAGCCGTCGCTATGGCCAGCGTTGTTCTCGGAAACATGACCGATACTTTAGGATAC
ATTCAATCGCTGATCAAACATTCTCACGATCCTGCGGTAGAGCGCGCGCTGGCTCAGTGCGCCGAGCTGTACCGGCCGGT
GGTCAAGTTTAATATTCCTCAGGCGATGGAGGCAATGCAGGGCGGCAAATTCGGATTTGCGATATATGTACTCGGAGACG
CCGAGAAGCAGACTGATTCTTGTCAGAAAGGGATCACGAATACCGGCGCCGACGATGAAAGCTCGGTGGCTGTTACGGCT
AGAAACAAGCTAGTTAAGAATCTTTGTGACGTGGCGATTTCTGTGCTTAAGTCTCTTATGAGTCTTTAA