Details for Lyrate rockcress Locus 16046747

Position : sca3 ( 5`- 2185271 .. 2184307 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046747

Protein [Map View]
MEESLALATTSLAKRKAESDPADDIEESGDEEYEYVDSEEDENEEPVDEAMAFALALLAKRKTVAEESGYEVDESGDEKE
ESGVEYSYSGDMLVIKSKWWVEPEWDVDSFDGLEYDSSEEEDEMSNEEDELKWRRVKRQLIESKGFYVDPELMPMQNYSP
IKAVADLEWSAGLGQTYREYFAGWLVSVSKHSTNTRFTCDNISFVLPGLNVEFVEVVRGAFSAGPKSKSYITCMAREKPD
GPLVEYQCKAWSTFVQHENYPILCRPAPITKLSNQN*

DNA
ATGGAGGAATCTTTGGCCCTCGCCACTACTTCCCTGGCAAAACGTAAGGCCGAGTCTGACCCAGCGGATGATATAGAAGA
GAGCGGCGATGAAGAATACGAATACGTCGACTCTGAGGAGGATGAGAATGAAGAACCCGTGGATGAAGCTATGGCCTTCG
CTCTTGCTTTACTGGCAAAACGTAAGACCGTGGCCGAAGAGAGCGGCTATGAGGTTGATGAGAGCGGCGATGAAAAGGAA
GAGAGTGGCGTTGAATACTCTTACTCTGGAGACATGCTCGTCATAAAGTCCAAGTGGTGGGTCGAACCTGAATGGGATGT
GGACAGCTTCGATGGTCTCGAGTACGATTCCTCTGAAGAGGAAGATGAAATGTCCAATGAAGAGGATGAACTAAAGTGGC
GCCGCGTCAAACGCCAGCTCATCGAGAGCAAGGGATTTTACGTGGATCCGGAGCTTATGCCAATGCAAAACTACTCACCA
ATCAAAGCAGTCGCTGATCTGGAATGGTCTGCGGGTTTGGGCCAAACCTACCGCGAGTACTTTGCAGGATGGCTTGTGTC
TGTCTCAAAACATTCAACCAATACAAGGTTTACTTGTGATAACATTTCTTTTGTCTTGCCTGGGTTGAATGTGGAGTTTG
TGGAAGTGGTGCGAGGTGCATTTTCTGCAGGACCTAAATCAAAGTCGTACATTACATGTATGGCTAGGGAGAAACCTGAT
GGGCCTCTTGTCGAGTATCAATGCAAGGCTTGGTCTACGTTTGTTCAACACGAGAACTATCCCATCCTCTGTAGACCTGC
TCCTATCACAAAGCTCTCAAACCAAAACTAG