Details for Lyrate rockcress Locus 16046744

Position : sca3 ( 5`- 6960479 .. 6958939 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046744

Protein [Map View]
MGRAARWFKGIFGMKKSKEKENRVSGDCGGEAGGSNIHRKVLQADSVWLRSYLAETDKEQNKHAIAVAAATAAAADAAVA
AAQAAVAVVRLTSNGRTGGYSGTTMERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLHSMQALIR
AQTSVRSQRINRNNLFNPRHSLERFDDSRSEIHSKRISISVEKQSNNNNAYDETSPKIVEIDTYKTKSRSKRMNVAVSEC
GDDFIYQAKDFEWSFPGEKCKFPTAQNTPRFSSSAANNHYYYTPPSPAKSVCRDVCFRPSYPGLMTPSYMANTQSFKAKV
RSHSAPRQRPDRKRLSLDEIMAARSSVSGVRMAQPQPQTETQMQMQQQKRSPCSYDNQFRQNESDFRFYN*

DNA
ATGGGAAGAGCTGCGAGATGGTTCAAGGGTATTTTCGGTATGAAGAAGAGCAAAGAGAAAGAAAACCGTGTCTCCGGTGA
CTGTGGAGGAGAAGCCGGTGGGTCTAACATTCACCGGAAAGTTCTTCAAGCTGACTCCGTCTGGCTCAGAAGTTACCTTG
CGGAAACAGACAAAGAACAGAACAAACACGCGATTGCGGTTGCTGCCGCTACAGCCGCGGCCGCAGACGCAGCGGTTGCA
GCGGCTCAGGCTGCTGTTGCGGTCGTCAGGTTAACAAGTAACGGAAGAACCGGAGGATATTCGGGGACCACAATGGAGCG
GTGGGCGGCCGTGAAAATTCAATCAGTCTTCAAGGGCTATTTGGCAAGAAAAGCGTTAAGAGCTTTGAAAGGTTTAGTGA
AGCTACAAGCTTTGGTAAGAGGTTACTTAGTCCGCAAACGCGCCGCCGAAACACTTCATAGCATGCAAGCTCTCATTAGA
GCCCAAACTAGCGTCCGATCGCAACGCATCAACCGCAACAACTTGTTTAATCCTCGACACTCACTTGAGAGGTTTGATGA
TTCAAGAAGTGAAATCCATAGCAAGAGAATATCAATCTCTGTAGAGAAACAGAGTAACAACAACAATGCGTACGATGAAA
CCAGTCCCAAGATTGTGGAGATTGACACATACAAAACGAAATCAAGATCAAAGAGAATGAATGTTGCTGTATCCGAATGT
GGAGATGATTTCATCTATCAAGCCAAAGATTTCGAATGGAGTTTTCCAGGAGAGAAATGCAAGTTTCCCACGGCTCAAAA
CACGCCGAGATTCTCTTCATCGGCGGCTAATAATCACTATTACTACACACCGCCATCGCCGGCGAAAAGCGTTTGCAGAG
ACGTTTGTTTTAGGCCAAGTTATCCTGGTTTGATGACACCAAGCTATATGGCTAATACGCAGTCGTTTAAAGCTAAGGTA
CGTTCGCATAGTGCACCAAGACAACGTCCTGATAGGAAACGGTTATCACTTGATGAGATTATGGCCGCTAGAAGTAGCGT
TAGCGGTGTTAGGATGGCGCAACCGCAACCGCAAACGGAAACGCAAATGCAAATGCAGCAACAGAAACGCTCTCCTTGTT
CGTATGATAATCAGTTTCGTCAGAACGAGAGTGATTTTAGATTCTATAATTAG