Details for Lyrate rockcress Locus 16046694

Position : sca3 ( 5`- 3104507 .. 3105403 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046694

Protein [Map View]
MGFSRAKRVTDPLADEVRARLVGCSFSSGSEHTGDGIEDYEDDDSPCLSDLVQGFLEDEVETVVDESRWCDQDSGSDSDS
DSELVELPDFADDIAKLLRNSLREDSYGRTVLVHVARAMEVLSSLESQHEQRAVFQRKVMSFLRELGHNAAICKTKWRSS
GGLTAGNHEFIDVMYTPSASSQPVRYIVDLDFASRFQIARPTSQYARVLQSLPAVFVGRGDDLKRILRLVCDAARISLRN
RGLTLPPWRKNRYMQTRWLGPYKRTTNLTPSSTAVNTVICRAIGFDNAVGGRLFVRTR*

DNA
ATGGGTTTCTCTAGAGCTAAACGTGTCACTGATCCACTCGCCGACGAGGTTAGGGCTCGTCTCGTTGGATGCAGCTTTAG
CAGCGGCAGCGAACATACCGGCGACGGAATCGAAGACTACGAAGACGACGACTCACCTTGTCTCTCCGATCTCGTACAAG
GCTTCTTGGAGGATGAAGTTGAGACCGTTGTTGATGAGTCACGGTGGTGTGATCAAGACTCCGGTTCCGACTCGGATTCT
GACTCGGAACTAGTCGAGCTCCCTGACTTTGCCGACGATATTGCCAAACTTCTGAGGAACTCTCTCAGGGAAGATTCATA
CGGACGAACGGTGCTGGTACACGTGGCGAGAGCGATGGAAGTGTTGTCGTCTCTTGAATCTCAGCACGAACAACGTGCCG
TTTTCCAGCGTAAGGTCATGTCTTTTCTTAGAGAACTCGGCCACAATGCGGCCATCTGCAAAACTAAATGGAGATCCTCC
GGCGGACTCACCGCCGGAAACCACGAGTTCATCGACGTCATGTATACACCTTCCGCCTCGTCTCAGCCCGTCCGTTACAT
CGTCGATTTAGATTTCGCGTCGCGGTTTCAAATCGCGAGGCCAACTTCACAGTACGCGCGTGTGCTTCAATCGCTTCCGG
CGGTTTTCGTTGGAAGAGGGGACGATCTGAAGCGGATCTTGCGGCTCGTATGTGACGCTGCGAGGATTTCTCTTAGAAAC
CGCGGCCTCACGCTACCGCCGTGGAGGAAGAATCGTTATATGCAGACGCGGTGGCTTGGTCCTTACAAACGCACCACCAA
CTTAACGCCGTCATCTACCGCCGTTAACACCGTCATATGTCGTGCCATCGGTTTCGATAATGCCGTCGGTGGCCGTCTAT
TTGTGCGAACACGATAA