Details for Lyrate rockcress Locus 16046670

Position : sca3 ( 5`- 1432815 .. 1433709 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046670

Protein [Map View]
YRYALGYVNKNNSCRSHKVLRLIDDYIYLAVNHAPENRFSWYEIYDIETYLWTTLDVPPILEDIVLSACNSGYKLDDHII
CFDFTSERVGPLLRLPFCAGLHDYVTLSCVREEKLAALLTHNESNPYEFEIWITTKIEYEKVSWSKILEMDTGPLADRPI
AFTHESFFVDEEKNVSMGFDDLNRHTVNIIGEAGYFIELDLGVPVADINCGARRPHLCPYVPSSVQIKQPPGGKRKRKTI
LEKRQYDQNMLRLAAFIKRTKQEENKWRKRVRVGLKKKTIFEA*

DNA
TACAGGTACGCTCTAGGATACGTGAACAAGAACAACTCTTGTCGAAGCCACAAAGTCTTGAGGCTTATAGATGATTACAT
CTATTTGGCCGTGAACCATGCACCCGAAAACCGGTTTTCATGGTATGAAATCTACGATATTGAAACCTATTTATGGACAA
CTCTTGACGTCCCCCCCATATTGGAGGATATCGTGTTATCAGCATGTAACTCAGGATACAAACTCGACGATCACATAATC
TGTTTTGATTTCACAAGTGAGAGAGTTGGGCCGCTTCTGCGTCTACCGTTTTGCGCTGGGCTTCATGACTATGTGACTTT
ATCTTGTGTTAGAGAAGAGAAGCTTGCGGCTTTACTTACCCACAACGAATCAAATCCATATGAGTTTGAGATATGGATTA
CGACTAAGATTGAGTATGAAAAAGTGTCATGGAGCAAGATTTTGGAAATGGATACAGGACCATTGGCTGACAGGCCGATT
GCATTTACACATGAGAGTTTCTTTGTTGACGAGGAGAAGAATGTCTCCATGGGTTTTGATGACTTGAATCGCCACACAGT
TAACATCATTGGAGAGGCCGGATACTTTATAGAATTGGATCTCGGAGTACCTGTAGCCGACATAAACTGTGGGGCACGAA
GGCCACATTTGTGCCCTTATGTTCCAAGTTCAGTGCAAATCAAACAACCTCCCGGAGGCAAAAGGAAACGAAAAACCATT
CTAGAAAAGCGTCAATATGATCAAAACATGTTGAGACTTGCCGCCTTTATAAAGCGAACCAAGCAGGAGGAAAATAAATG
GAGAAAACGAGTCCGCGTGGGTCTAAAGAAGAAAACGATTTTTGAAGCCTAA