Details for Lyrate rockcress Locus 16046642

Position : sca3 ( 5`- 9098497 .. 9095648 -3` )
Annotation : [B2G] mrna capping enzyme family protein
External links : CoGe
PGDD synteny : 16046642

Protein [Map View]
MKRGFSESPSSSGPPPSSRFKSNPEGDSQFLEDETTKNFARKVADHYSRRTNQTLEEREASPIIHLKKLNNWIKSVLIQL
YARPDDAVLDLACGKGGDLIKWDKARIGYYVGIDIAEGSIEDCRTRYNGDADHHQRRKKFSFPSRLLCGDCFEVELDKIL
EEDAPFDICSCQFAMHYSWTTEARARRALANVSALLRPGGVFIGTMPDANVIIKKLREAEGLEIGNSVYWIRFGEEYSQK
KFKSSSPFGIEYVFHLEDAVDCPEWIVPFNVFKSLAEEYDLELVFVKNSHEFVHEYMKKPEFVELMRRLGALGDGNNDQS
TLSADEWEAAYLYLSFVLRKRGEPDGARRSGRRKNGKMNLSKDDVLYIDS*

DNA
ATGAAACGAGGATTCTCCGAATCTCCTTCAAGCTCTGGTCCTCCTCCTTCTTCCCGATTCAAATCTAATCCCGAAGGTGA
TTCTCAGTTTCTGGAAGATGAAACCACAAAGAATTTTGCCCGGAAAGTTGCTGATCATTACAGTCGAAGAACAAACCAAA
CATTGGAAGAGCGAGAAGCTAGTCCCATCATTCATTTGAAGAAACTTAACAATTGGATTAAAAGTGTGTTGATCCAGCTT
TATGCTCGTCCTGACGATGCTGTTCTCGACCTTGCCTGTGGGAAGGGTGGTGATTTGATCAAGTGGGATAAGGCGAGAAT
CGGGTACTATGTTGGAATCGATATTGCTGAAGGGTCGATTGAAGATTGTCGCACGCGTTATAATGGTGATGCAGACCATC
ATCAACGGCGTAAAAAGTTCAGTTTTCCGTCTCGATTACTATGTGGAGATTGTTTTGAGGTAGAGCTAGACAAGATTCTT
GAAGAGGATGCCCCTTTTGATATCTGCAGTTGCCAGTTTGCTATGCATTACTCATGGACTACTGAGGCACGTGCACGACG
AGCTTTGGCAAATGTTTCAGCTTTACTTCGTCCAGGAGGTGTCTTTATCGGAACAATGCCAGATGCCAATGTTATTATAA
AAAAACTCAGAGAAGCTGAAGGTTTGGAGATTGGTAATAGTGTATACTGGATTCGTTTTGGTGAAGAGTATTCCCAAAAG
AAGTTCAAATCTAGCAGCCCATTTGGTATCGAATACGTATTTCATCTGGAGGATGCTGTTGATTGTCCTGAATGGATTGT
GCCCTTTAACGTCTTCAAGTCTTTAGCAGAAGAGTATGATTTAGAGTTGGTATTTGTGAAGAACTCCCACGAGTTTGTCC
ATGAGTATATGAAAAAGCCAGAGTTTGTGGAACTCATGAGAAGGCTTGGTGCTTTGGGTGATGGTAACAATGATCAGAGC
ACATTATCAGCTGATGAATGGGAAGCTGCATATCTATACCTCTCTTTTGTCTTGAGGAAGAGGGGAGAACCAGATGGAGC
TCGAAGGAGCGGACGGAGGAAGAATGGGAAAATGAACTTATCGAAAGACGATGTTTTGTATATCGATAGCTGA