Details for Lyrate rockcress Locus 16046632

Position : sca1 ( 5`- 7789980 .. 7791272 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_472077 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16046632

Protein [Map View]
MVRTPCCKAELGLKKGAWTPEEDQKLLSYLNRHGEGGWRTLPEKAGLKRCGKSCRLRWANYLRPDIKRGEFTEDEECSII
SLHALHGNKWSAIARGLPGRTDNEIKNYWNTHIKKRLIKKGIDPVTHKGLNSDTDKSENLPEKQNVNQTTSDDDLDNDKA
KKNNKNSGLSSARFLNRVANRFGKRINQSVLSDIIGSGGPLATTSHTTTTTTTSVSVDSESDKSTSSSFAPTSNLLCHGT
VATTPVSSNFNVDGNLNPTSSSSTFSDASVNNPLMYCDNFVGNNNVDDENTIGFPTFLNDEDFMMLEESCVDNTAFMKEL
TRFLYEDENDVVDVPPVYERRDMFDEIDNYFG*

DNA
ATGGTGCGGACACCGTGTTGCAAAGCTGAATTAGGGTTAAAGAAAGGAGCTTGGACTCCCGAGGAAGATCAGAAGCTTCT
CTCTTACCTCAACCGTCACGGTGAAGGTGGATGGCGAACTCTCCCCGAAAAAGCTGGACTCAAGAGGTGCGGCAAAAGCT
GCAGACTGAGATGGGCCAATTATCTTAGACCTGACATCAAAAGAGGAGAGTTCACTGAAGACGAAGAATGTTCTATCATC
TCTCTTCACGCCCTTCACGGCAACAAATGGTCCGCTATAGCTCGTGGATTACCAGGAAGAACCGATAACGAGATCAAGAA
CTACTGGAACACTCATATCAAGAAACGTTTGATTAAGAAAGGTATTGATCCGGTTACACACAAGGGCTTAAACTCCGATA
CCGACAAATCAGAAAACCTCCCGGAGAAACAAAACGTTAATCAGACAACTAGTGACGATGATCTTGATAATGACAAGGCG
AAGAAGAACAACAAGAATTCCGGATTATCATCGGCTAGGTTCTTGAACAGAGTAGCTAATAGGTTCGGAAAGAGAATCAA
TCAGAGTGTTCTGTCTGATATTATCGGAAGTGGAGGCCCACTTGCTACTACTAGTCACACTACTACTACTACTACTACAA
GTGTTTCCGTTGACTCTGAATCAGATAAGTCAACGAGTTCTTCCTTCGCACCAACCTCGAATCTTCTCTGCCATGGGACC
GTTGCAACAACACCTGTGTCATCGAACTTTAACGTTGATGGTAACCTTAATCCGACGTCTTCTTCGTCCACGTTCTCTGA
TGCCTCCGTTAACAATCCTCTAATGTACTGCGATAATTTCGTTGGTAATAATAACGTTGATGATGAGAATACTATCGGGT
TCCCGACATTTCTGAATGATGAAGATTTCATGATGTTGGAGGAATCTTGTGTTGACAACACTGCGTTCATGAAAGAACTT
ACTAGGTTTCTTTATGAGGATGAAAATGACGTCGTTGATGTGCCGCCGGTCTATGAACGTCGAGATATGTTTGACGAGAT
TGATAACTATTTTGGATGA