Details for Lyrate rockcress Locus 16046627

Position : sca3 ( 5`- 5202284 .. 5201127 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046627

Protein [Map View]
MASGCVKNVGTSPSHSWTSSKMSLTRESQPLAPQLENEDPVDNFEFLLEDPVTMLSADELFSDGKLVPLKFSAVTNPEEK
PMTSVVHTAVKPCRRLEMKISGVVDPYLFSPRAPRCTVRWRELLGLKRLAKTQEEASASSSSRLSSSSPNPKTASFRHFL
NRSSKSTAQPPSHPPPGKDSDILESSSTSISSSRLSLSSSSSSGHELDDLPRLSLDLDNKPGTPNPFARSRAHHHHHLRN
QNQQRKPRRNAPADELTESSIETRAMTVTADSPRLNASGKIVFHGLERSSSSPGNFTGGPRMKLHHGMPRSHSANVRITP
VLNVPVSSLRSGPKSGLFFGQLFASSSSSSSSSSLASSSGNRAQLQSNNIKNRTNRSRLEPTSEL*

DNA
ATGGCGTCGGGTTGCGTTAAAAATGTGGGTACTTCACCGAGTCACTCATGGACGAGCTCCAAAATGTCATTGACCCGTGA
ATCTCAACCGTTGGCTCCACAGTTGGAAAACGAAGATCCTGTTGACAACTTTGAGTTTCTTCTCGAAGATCCCGTCACAA
TGCTATCCGCCGACGAGCTTTTCTCCGACGGAAAGCTAGTCCCGCTTAAGTTTTCCGCCGTGACTAATCCGGAAGAGAAG
CCTATGACGTCGGTGGTTCATACGGCGGTGAAACCATGCCGAAGATTGGAAATGAAGATCTCCGGCGTCGTCGATCCTTA
TCTCTTCTCTCCGAGAGCTCCTCGTTGCACCGTGAGATGGCGTGAGCTTTTAGGTCTAAAGAGACTCGCCAAAACACAAG
AAGAAGCGTCAGCGTCGTCCTCATCGCGTTTGTCTTCTTCTTCTCCAAACCCCAAAACGGCATCGTTTAGGCATTTTCTC
AACCGGAGTTCTAAATCCACCGCTCAACCACCGTCTCACCCGCCGCCGGGAAAAGACTCAGACATCTTGGAATCGTCGTC
AACGTCGATCTCCTCTTCACGTCTCTCTCTCTCGTCGTCTTCTTCCTCCGGTCACGAGCTAGACGACCTTCCAAGACTAT
CTTTAGATCTCGACAACAAACCCGGAACACCAAACCCGTTCGCTCGGTCACGTGCTCACCACCACCACCATCTGCGTAAC
CAGAACCAACAAAGAAAGCCACGACGTAACGCACCGGCTGATGAATTGACAGAGAGTAGTATTGAGACAAGGGCAATGAC
GGTGACGGCGGATAGTCCTAGACTCAATGCTTCAGGGAAGATCGTGTTTCATGGACTGGAGAGAAGCTCAAGCAGTCCCG
GTAACTTCACCGGAGGACCAAGAATGAAGCTTCACCATGGAATGCCGAGATCTCACTCCGCAAATGTCAGAATCACTCCT
GTTCTCAATGTCCCTGTCTCTTCTCTCCGTAGCGGACCCAAATCAGGTCTCTTCTTCGGCCAGCTTTTCGCTTCTTCGTC
TTCTTCTTCTTCGTCGTCGTCATTGGCTTCGTCGTCTGGAAACAGAGCACAGTTGCAGAGCAATAACATCAAGAACCGTA
CCAATCGAAGCAGACTTGAACCGACAAGCGAACTCTAA