Details for Lyrate rockcress Locus 16046625

Position : sca3 ( 5`- 7104897 .. 7101517 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16046625

Protein [Map View]
MTSHGGGGVRGERIHTVQPERDLVANWEVDLSEKLEEYLLKICSGEITGNEEDEQIPVNFAEAALLLQGSVQVYSKKVEY
LYNLVLRTLEFLSKQRDQEQSKGTSNEAEASSSRQVDEEENDLFWNVDDIPVDTKNRLDSSVGGDTCPSQFVKPPANLVV
LEGDCLDTSGDGGELESYLLATTHLYRDFILLDPCDAVAVNEFLGDDYAGKGKNNAHRGSSVRKSFHSSVGRSGGSARKS
SVGKNQGTNVNLSPIGGNGPNVQNCDQGSQPPVFGDNDHGFDMDNEYGGTMDFSDTDADEDDPWKPLNPYEPGKLKVKPF
KKVKNFKKIGWSITKDHMTSMFPLARPDGPISSELIGIWKMRGCASKGEQESQDIPYYEKLREMLVNGGNQPCGANGNYK
DNDKDNHDEANNGDFHDCGEHDGDDAEHPFMDEDVLNMNDGGAAEFHNYDGFENGESNCQESLEDLCRSHLDALLANIAK
SEKQTDLAARVSTWKQKIEQNLEEQELHPPFDIQEYGERIINKLTVEESGNVETFTDLMKDQEKHEVARAFSALLQLVNN
GDVDLEKPGNSTNEPMCYTAVKPFSVRLLKDHNRKNENSAMQLPQKRAKSPVTKGKSHESPPPKKPNTCSVSSQTRKVSL
KISKINSVGTRWTPNSKKRRKGRCEDVAEVTEISSIGKSLGKL*

DNA
ATGACGAGTCACGGTGGCGGTGGAGTCCGCGGCGAGAGGATTCATACGGTACAGCCGGAGAGAGATTTGGTGGCTAATTG
GGAAGTGGATTTGTCGGAGAAGCTAGAAGAGTACCTCCTCAAAATTTGTTCCGGAGAAATCACTGGGAATGAAGAAGATG
AGCAAATTCCTGTGAATTTCGCTGAAGCTGCTTTGCTGCTTCAGGGTTCGGTTCAGGTTTATAGCAAGAAAGTGGAGTAC
TTGTACAATTTAGTTCTACGTACGTTGGAGTTTCTATCGAAGCAAAGAGACCAGGAACAGTCCAAAGGTACATCAAACGA
GGCTGAGGCAAGCTCCTCACGTCAGGTTGATGAAGAAGAAAATGATCTCTTCTGGAATGTAGATGACATCCCAGTGGACA
CAAAGAATAGATTGGACAGTTCGGTTGGCGGAGATACTTGTCCAAGTCAATTTGTTAAGCCTCCGGCGAATCTAGTTGTT
CTTGAAGGTGACTGTTTGGATACTAGTGGTGACGGAGGAGAATTGGAATCCTATCTGTTGGCAACTACACATCTCTACCG
GGATTTTATTCTATTAGACCCATGTGATGCTGTAGCGGTGAATGAATTCTTAGGTGATGACTATGCTGGTAAAGGAAAGA
ACAATGCTCACAGAGGTAGCTCAGTTCGTAAAAGTTTTCACTCATCTGTGGGACGTTCTGGAGGTAGTGCTCGTAAGTCA
TCTGTGGGAAAGAATCAGGGCACCAATGTCAACTTGTCCCCAATAGGTGGGAATGGTCCCAATGTTCAAAATTGTGACCA
AGGGTCTCAGCCTCCTGTTTTTGGAGATAATGATCATGGTTTTGACATGGATAATGAATATGGAGGAACCATGGATTTTA
GTGATACAGATGCTGATGAAGATGATCCGTGGAAGCCACTGAATCCCTATGAACCAGGGAAGTTGAAAGTGAAGCCTTTC
AAAAAAGTAAAAAATTTCAAAAAGATTGGCTGGAGCATTACCAAGGACCATATGACTTCCATGTTCCCTCTCGCTAGACC
AGACGGTCCCATCAGTTCGGAGCTTATTGGAATTTGGAAGATGCGCGGTTGTGCTAGTAAAGGCGAGCAAGAATCACAAG
ACATTCCCTATTACGAGAAGCTTCGAGAGATGCTTGTGAATGGAGGAAACCAACCTTGTGGTGCTAACGGCAATTACAAG
GACAATGATAAGGATAACCATGATGAAGCCAATAATGGTGACTTCCATGATTGTGGAGAGCATGATGGTGATGATGCAGA
ACATCCCTTCATGGATGAAGATGTTCTCAATATGAATGATGGTGGAGCTGCTGAGTTTCACAACTATGATGGATTTGAAA
ACGGCGAATCAAATTGTCAAGAAAGCTTGGAAGATCTCTGCCGCTCACACCTGGATGCTCTTCTCGCTAACATAGCTAAA
AGTGAGAAGCAAACAGATCTGGCTGCTCGGGTTTCAACGTGGAAACAGAAAATTGAGCAAAACCTAGAAGAACAAGAGCT
ACACCCTCCTTTTGACATTCAAGAATATGGAGAAAGGATTATTAACAAACTGACAGTTGAAGAGAGCGGAAACGTCGAGA
CCTTTACCGATCTTATGAAAGACCAAGAAAAGCACGAGGTAGCTCGGGCCTTCTCTGCGCTTCTCCAGTTGGTGAACAAT
GGAGACGTTGATCTGGAAAAACCTGGGAACTCCACAAACGAACCAATGTGTTATACAGCGGTTAAACCTTTCAGTGTTCG
GTTGCTCAAAGATCATAATAGAAAGAATGAGAACAGTGCGATGCAGTTACCCCAGAAACGAGCTAAGTCTCCAGTAACCA
AAGGCAAATCTCACGAGTCACCACCACCAAAGAAGCCAAACACATGTTCTGTCTCAAGCCAGACTCGGAAAGTCTCGCTA
AAGATCTCAAAGATCAACAGTGTTGGCACGAGATGGACACCAAACAGTAAGAAGAGACGAAAGGGTCGATGTGAAGATGT
AGCTGAGGTAACTGAAATTTCTTCAATCGGAAAGTCTTTGGGGAAATTGTGA